Structural insight into an essential assembly factor network on the pre-ribosome. Determined by solution NMR. Released 3 Dec 2014.
Explore 2MVF in 3D Show helices and sheets RCSB PDB PDBe
2MVF contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 181-186 | 6 | 1 |
| β-strand | 191-196 | 6 | 1 |
| β-strand | 199-201 | 3 | 1 |
| α-helix | 215-216 | 2 | |
| β-strand | 219-225 | 7 | 1 |
| β-strand | 239-248 | 10 | 1 |
| β-strand | 254-259 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uncharacterized protein | A | protein | 94 | Chaetomium thermophilum | G0S081 (AlphaFold model) |
>2MVF_1 Uncharacterized protein (chains A) YERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEVNVSD LGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV
A network of assembly factors is involved in remodeling rRNA elements during preribosome maturation. Baler, J., Paternoga, H., Holdermann, I. et al. J Cell Biol (2014) 207:481-498. DOI 10.1083/jcb.201408111 · PubMed
Other PDB entries of the same protein (UniProt G0S081 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MVF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.