Solution structure of human Myosin VI isoform3 (998-1071). Determined by solution NMR. Released 9 Mar 2016.
Explore 2N11 in 3D Show helices and sheets RCSB PDB PDBe
2N11 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-30 | 24 | |
| α-helix | 34-44 | 11 | |
| α-helix | 46-48 | 3 | |
| α-helix | 63-74 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Unconventional myosin-VI | A | protein | 74 | Homo sapiens | Q9UM54 (AlphaFold model) |
>2N11_1 Unconventional myosin-VI (chains A) QQQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQ MAKEMSEFLSRGPA
Myosin VI Contains a Compact Structural Motif that Binds to Ubiquitin Chains. He, F., Wollscheid, H.P., Nowicka, U. et al. Cell Rep (2016) 14:2683-2694. DOI 10.1016/j.celrep.2016.01.079 · PubMed
Other PDB entries of the same protein (UniProt Q9UM54 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2N11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.