6E5N: Human Myosin VI isoform 3

Solution structure of human Myosin VI isoform 3 (1050-1131) in complex with Clathrin light chain a (46-61). Determined by solution NMR. Released 20 Nov 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 782
Mol. weight: 12.37 kDa
Released: 20 Nov 2019

Explore 6E5N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6E5N contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	47-54	8

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	1055-1068	14
α-helix	1076-1078	3
α-helix	1091-1100	10
α-helix	1104-1129	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-VI	B	protein	87	Homo sapiens	Q9UM54 (AlphaFold model)
Clathrin light chain A	A	protein	24	Homo sapiens	P09496 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>6E5N_1 Unconventional myosin-VI (chains B)
GPLGSRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDI
ELLAACREEFHRRLKVYHAWKSKNKKR

Sequence of entity 2 (A), FASTA

>6E5N_2 Clathrin light chain A (chains A)
GPLGSPEFIENDEAFAILDGGAPG

Primary citation

Clathrin light chain A drives selective myosin VI recruitment to clathrin-coated pits under membrane tension. Biancospino, M., Buel, G.R., Nino, C.A. et al. Nat Commun (2019) 10:4974-4974. DOI 10.1038/s41467-019-12855-6 · PubMed

Other PDB entries of the same protein (UniProt Q9UM54 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J56 1.8 Å, Crystal structure of Myosin VI CBD in complex with Tom1 MBM
8W41 3.54 Å, Cryo-EM structure of Myosin VI in the autoinhibited state
2N0Z Solution structure of MyUb (1080-1122) of human Myosin VI
2N10 Solution structure of MyUb (1080-1131) of human Myosin VI
2N11 Solution structure of human Myosin VI isoform3 (998-1071)
2N12 Solution structure of human Myosin VI isoform3 (1050-1131)
2N13 Complex structure of MyUb (1080-1122) of human Myosin VI with K63-diUb

Browse structure collections

About this viewer

MolViewer shows 6E5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.