2N1G: C-terminal domain of human polymerase Rev1

Structure of C-terminal domain of human polymerase Rev1 in complex with PolD3 RIR-motif. Determined by solution NMR. Released 13 Apr 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 888
Mol. weight: 12.73 kDa
Released: 13 Apr 2016

Explore 2N1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N1G contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	1159	1	1
β-strand	1162	1	1
α-helix	1165-1178	14
α-helix	1184-1199	16
α-helix	1203-1219	17
α-helix	1224-1243	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein REV1	A	protein	94	Homo sapiens	Q9UBZ9 (AlphaFold model)
DNA polymerase delta subunit 3	B	protein	16	Homo sapiens	Q15054 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N1G_1 DNA repair protein REV1 (chains A)
NLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLM
QQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT

Sequence of entity 2 (B), FASTA

>2N1G_2 DNA polymerase delta subunit 3 (chains B)
KGNMMSNFFGKAAMNK

Primary citation

Interaction between the Rev1 C-Terminal Domain and the PolD3 Subunit of Pol zeta Suggests a Mechanism of Polymerase Exchange upon Rev1/Pol zeta-Dependent Translesion Synthesis. Pustovalova, Y., Magalhaes, M.T., D'Souza, S. et al. Biochemistry (2016) 55:2043-2053. DOI 10.1021/acs.biochem.5b01282 · PubMed

Other PDB entries of the same protein (UniProt Q9UBZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
6ASR 2.36 Å, REV1 UBM2 domain complex with ubiquitin
6WS5 2.47 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
3GQC 2.5 Å, Structure of human Rev1-DNA-dNTP ternary complex
4GK0 2.7 Å, Crystal structure of human Rev3-Rev7-Rev1 complex
9VGW 2.7 Å, Crystal structure of human PCNA in complex with REV1 PIP-box
4BA9 2.73 Å, The structural basis for the coordination of Y-family Translesion DNA Polymerases by Rev1
3VU7 2.8 Å, Crystal structure of REV1-REV7-REV3 ternary complex
4GK5 3.21 Å, Crystal structure of human Rev3-Rev7-Rev1-Polkappa complex
2EBW Solution structure of the BRCT domain from human DNA repair protein REV1
2LSI Solution structure of polymerase-interacting domain of human Rev1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 2N1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.