2N80: P75NTR DD:RhoGDI

p75NTR DD:RhoGDI. Determined by solution NMR. Released 23 Dec 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 2,112
Mol. weight: 30.06 kDa
Released: 23 Dec 2015

Explore 2N80 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N80 contains 12 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	335	1	1
α-helix	336-338	3
α-helix	341-351	11
α-helix	358-366	9
α-helix	370-377	8
α-helix	382-390	9
β-strand	397	1	1
α-helix	398-407	10
α-helix	411-417	7

Chain B: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
α-helix	41-46	6
α-helix	49-53	5
α-helix	54-58	5
β-strand	70-78	9	2
β-strand	86-89	4	2
β-strand	101-105	5	3
β-strand	109-110	2	4
β-strand	111-118	8	2
β-strand	123-134	12	3
β-strand	137-149	13	3
β-strand	155-159	5	2
β-strand	163-164	2	4
α-helix	169-172	4
β-strand	174-182	9	3
β-strand	190-199	10	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 16	A	protein	94	Homo sapiens	P08138 (AlphaFold model)
Rho GDP-dissociation inhibitor 1	B	protein	174	Homo sapiens	P52565 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N80_1 Tumor necrosis factor receptor superfamily member 16 (chains A)
GLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQ
DSATLDALLAALRRIQRADLVESLCSESTATSPV

Sequence of entity 2 (B), FASTA

>2N80_2 Rho GDP-dissociation inhibitor 1 (chains B)
AQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDL
TGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG
PRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD

Primary citation

Structural basis of death domain signaling in the p75 neurotrophin receptor. Lin, Z., Tann, J.Y., Goh, E.T. et al. Elife (2015) 4:11692-11692. DOI 10.7554/eLife.11692 · PubMed

Other PDB entries of the same protein (UniProt P08138 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EWV 2.6 Å, Crystal Structure of calmodulin complexed with a peptide
2N83 p75NTR DD:RIP2 card
2N97 DD homodimer
5ZGG NMR structure of p75NTR transmembrane domain in complex with NSC49652
7CSQ Solution structure of the complex between p75NTR-DD and TRADD-DD
8X8T NMR structure of p75NTR juxtamembrane domain in complex with RhoGDI N-terminal domain…

Browse structure collections

About this viewer

MolViewer shows 2N80 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.