2N9E: SUMO-2

Structure of SUMO-2 bound to phosphorylated RAP80 SIM. Determined by solution NMR. Released 20 Jan 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 870
Mol. weight: 12.47 kDa
Released: 20 Jan 2016

Explore 2N9E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2N9E contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	40-42	3	1

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
β-strand	29-35	7	1
α-helix	40-51	12
α-helix	55-57	3
β-strand	59-62	4	1
β-strand	65-66	2	1
α-helix	67-68	2
α-helix	78-79	2
β-strand	83-87	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRCA1-A complex subunit RAP80	A	protein	15	Homo sapiens	Q96RL1 (AlphaFold model)
Small ubiquitin-related modifier 2	B	protein	95	Homo sapiens	P61956 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2N9E_1 BRCA1-A complex subunit RAP80 (chains A)
XEDAFIVISDSDGEX

Sequence of entity 2 (B), FASTA

>2N9E_2 Small ubiquitin-related modifier 2 (chains B)
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Primary citation

Molecular Basis for Phosphorylation-dependent SUMO Recognition by the DNA Repair Protein RAP80. Anamika, Spyracopoulos, L. J Biol Chem (2016) 291:4417-4428. DOI 10.1074/jbc.M115.705061 · PubMed

Other PDB entries of the same protein (UniProt Q96RL1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SQY 2.92 Å, Cryo-EM structure of the ARISC(E33A)-RAP80:K63-Ub7 complex (Composite map)
9SMP 3.0 Å, BRCA1-A complex bound to K63-polyUbATA - open form double State P
9SMN 3.2 Å, BRCA1-A complex bound to K63-polyUbATA - open form StateC StateP
9SNA 3.2 Å, BRCA1-A complex bound to K63-diUbATA - open form StateC StateP
9SMR 3.25 Å, Structure of apo BRCA1-A complex in presence of K63-oligoUbATA
9SMS 3.3 Å, BRCA1-A complex: Ubiquitin bound to BRE at the wrist site (focused 3D class)
9SO9 3.4 Å, BRCA1-A complex bound to K63-oligoUbATA - closed form StateC*
2MKF Solution structure of the E81 deletion mutant of the tandem UIMs of RAP80
2MKG Solution structure of the tandem UIMs of RAP80
2RR9 The solution structure of the K63-Ub2:tUIMs complex

Browse structure collections

About this viewer

MolViewer shows 2N9E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.