2NXP: NTD2 domain of the human TAF5 subunit of TFIID

Structure of NTD2 domain of the human TAF5 subunit of TFIID. Determined by X-ray diffraction at 2.17 Å resolution. Released 9 Jan 2007.

Method

X-ray diffraction

Resolution

2.17 Å

Organism

Homo sapiens

Chains

8

Atoms

10,515

Mol. weight

151.06 kDa

Ligands

CA

Released

9 Jan 2007

Explore 2NXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NXP contains 124 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Molecules and chains

>2NXP_1 Transcription initiation factor TFIID subunit 5 (chains A, B, C, D, E, F, G, H)
GSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHM
YLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVL
RISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFD

Ligands and cofactors

Primary citation

Structural analysis and dimerization potential of the human TAF5 subunit of TFIID. Bhattacharya, S., Takada, S., Jacobson, R.H. Proc Natl Acad Sci U S A (2007) 104:1189-1194. DOI 10.1073/pnas.0610297104 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q15542 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 6F3T 2.5 Å, Crystal structure of the human TAF5-TAF6-TAF9 complex
• 7EGG 2.77 Å, TFIID lobe B subcomplex
• 7EGF 3.16 Å, TFIID lobe A subcomplex
• 7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
• 7EG9 3.7 Å, TFIID-based intermediate PIC on SCP promoter
• 7EGC 3.9 Å, p53-bound TFIID-based holo PIC on HDM2 promoter
• 7ENA 4.07 Å, TFIID-based PIC-Mediator holo-complex in pre-assembled state (pre-hPIC-MED)
• 7EGA 4.1 Å, TFIID-based intermediate PIC on PUMA promoter
• 7ENC 4.13 Å, TFIID-based PIC-Mediator holo-complex in fully-assembled state (hPIC-MED)
• 8GXS 4.16 Å, PIC-Mediator in complex with +1 nucleosome (T40N) in H-binding state
• 6MZC 4.5 Å, Human TFIID BC core
• 7EDX 4.5 Å, p53-bound TFIID-based core PIC on HDM2 promoter

Browse structure collections

About this viewer

MolViewer shows 2NXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.