2NZ1: Hypothetical protein GAMMAHV.M3

Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The CC-Chemokine CCL2/MCP-1. Determined by X-ray diffraction at 2.5 Å resolution. Released 25 Dec 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Murid herpesvirus 4, Homo sapiens
Chains: 6
Atoms: 10,672
Mol. weight: 151.52 kDa
Released: 25 Dec 2007

Explore 2NZ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NZ1 contains 43 α-helices and 89 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	1
α-helix	23-25	3
α-helix	29-35	7
α-helix	45-57	13
α-helix	61-65	5
β-strand	68-75	8	1
β-strand	77-79	3	2
β-strand	84-89	6	2
β-strand	104-112	9	1
α-helix	114-116	3
β-strand	127-131	5	2
β-strand	136-138	3	2
α-helix	141-143	3
β-strand	144-148	5	1
β-strand	151-159	9	1
α-helix	160-162	3
β-strand	168-173	6	2
β-strand	181-187	7	1
β-strand	193-201	9	1
α-helix	206-207	2
β-strand	208	1	1
β-strand	212-216	5	3
α-helix	221-224	4
α-helix	230-233	4
β-strand	244-246	3	4
β-strand	256-260	5	4
α-helix	263-268	6
β-strand	273-274	2	5
β-strand	279-285	7	4
α-helix	287-289	3
β-strand	294-301	8	3
β-strand	315-325	11	3
β-strand	328-331	4	3
β-strand	339-343	5	4
β-strand	349-354	6	4
α-helix	356-361	6
β-strand	362-369	8	3
β-strand	372-377	6	3

Chain B: 13 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	6
α-helix	23-25	3
α-helix	29-35	7
α-helix	45-57	13
α-helix	61-65	5
β-strand	68-75	8	6
β-strand	77-79	3	7
β-strand	84-89	6	7
β-strand	104-112	9	6
α-helix	114-116	3
β-strand	126-131	6	7
β-strand	136-138	3	7
α-helix	141-143	3
β-strand	144-148	5	6
β-strand	151-159	9	6
α-helix	160-162	3
β-strand	168-173	6	7
β-strand	181-189	9	6
β-strand	192-201	10	6
α-helix	206-207	2
β-strand	208	1	6
β-strand	212-216	5	8
α-helix	221-225	5
α-helix	230-233	4
β-strand	244-246	3	9
β-strand	256-260	5	9
α-helix	263-268	6
β-strand	273-274	2	10
β-strand	279-285	7	9
α-helix	287-289	3
β-strand	294-301	8	8
β-strand	315-325	11	8
β-strand	328-331	4	8
β-strand	339-343	5	9
β-strand	349-354	6	9
α-helix	356-361	6
β-strand	362-369	8	8
β-strand	372-377	6	8

Chain D: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	5
α-helix	19-21	3
β-strand	25-30	6	11
β-strand	41-45	5	11
β-strand	50-53	4	11
α-helix	58-69	12

Chain E: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	10
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	12
β-strand	41-45	5	12
β-strand	50-53	4	12
α-helix	58-68	11

Chain X: 10 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	13
α-helix	23-25	3
α-helix	29-35	7
α-helix	45-57	13
α-helix	61-65	5
β-strand	68-75	8	13
β-strand	77-79	3	14
β-strand	84-89	6	14
β-strand	104-112	9	13
β-strand	127-131	5	14
β-strand	136-138	3	14
α-helix	141-143	3
β-strand	144-147	4	13
β-strand	151-159	9	13
α-helix	160-162	3
β-strand	168-173	6	14
β-strand	181-189	9	13
β-strand	192-201	10	13
β-strand	208	1	13
β-strand	212-216	5	15
α-helix	221-224	4
β-strand	244-246	3	16
β-strand	256-260	5	16
α-helix	263-268	6
β-strand	273-274	2	17
β-strand	279-285	7	16
α-helix	287-289	3
β-strand	294-301	8	15
β-strand	307	1	18
β-strand	310	1	18
β-strand	315-325	11	15
β-strand	328-331	4	15
β-strand	339-343	5	16
β-strand	349-354	6	16
α-helix	356-361	6
β-strand	362-369	8	15
β-strand	372-377	6	15

Chain Y: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	17
α-helix	22-24	3
β-strand	25-30	6	19
β-strand	41-45	5	19
β-strand	50-53	4	19
α-helix	58-70	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical protein GAMMAHV.M3	A, B, X	protein	382	Murid herpesvirus 4	O41925 (AlphaFold model)
Small inducible cytokine A2	D, E, Y	protein	76	Homo sapiens	P13500 (AlphaFold model)

Sequence of entity 1 (A, B, X), FASTA

>2NZ1_1 Hypothetical protein GAMMAHV.M3 (chains A, B, X)
LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLH
ELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETP
EEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGA
KVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETG
MEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAY
FDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMP
NLVGVSLMLEGQQYRLEYFGDH

Sequence of entity 2 (D, E, Y), FASTA

>2NZ1_2 Small inducible cytokine A2 (chains D, E, Y)
QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKEAVIFKTIVAKEICADPKQKWV
QDSIDHLDKQTQTPKT

Primary citation

Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor. Alexander-Brett, J.M., Fremont, D.H. J Exp Med (2007) 204:3157-3172. DOI 10.1084/jem.20071677 · PubMed

Other PDB entries of the same protein (UniProt O41925 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MKF 2.1 Å, Viral chemokine binding protein M3 from murine gammaherpesvirus 68
2NYZ 2.6 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The C-…
1ML0 2.8 Å, Viral chemokine binding protein M3 from murine GAMMAHERPESVIRUS68 in complex with the…

Browse structure collections

About this viewer

MolViewer shows 2NZ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.