2O6R: Variable lymphocyte receptor B

Structural diversity of the hagfish Variable Lymphocyte Receptors B61. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Dec 2006.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Eptatretus burgeri
Chains: 1
Atoms: 1,565
Mol. weight: 19.65 kDa
Released: 26 Dec 2006

Explore 2O6R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O6R contains 3 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	29-31	3	1
β-strand	34-36	3	1
β-strand	55-57	3	1
β-strand	79-81	3	1
β-strand	103-105	3	1
β-strand	127-129	3	1
β-strand	151-153	3	1
β-strand	159	1	2
α-helix	163-175	13
α-helix	177-179	3
β-strand	180-181	2	1
β-strand	185	1	3
β-strand	186	1	2
β-strand	192	1	3
α-helix	193-195	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Variable lymphocyte receptor B	A	protein	177	Eptatretus burgeri	Q4G1L2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2O6R_1 Variable lymphocyte receptor B (chains A)
CPSRCSCSGTEIRCNSKGLTSVPTGIPSSATRLELESNKLQSLPHGVFDKLTQLTKLSLS
QNQIQSLPDGVFDKLTKLTILYLHENKLQSLPNGVFDKLTQLKELALDTNQLKSVPDGIF
DRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT

Primary citation

Structural diversity of the hagfish variable lymphocyte receptors. Kim, H.M., Oh, S.C., Lim, K.J. et al. J Biol Chem (2007) 282:6726-6732. DOI 10.1074/jbc.M608471200 · PubMed

Other PDB entries of the same protein (UniProt Q4G1L2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z62 1.7 Å, Crystal structure of the TV3 hybrid of human TLR4 and hagfish VLRB.61
2Z66 1.9 Å, Crystal structure of the VT3 hybrid of human TLR4 and hagfish VLRB.61
2Z63 2.0 Å, Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61
5GY2 2.1 Å, Crystal structure of a complex between Bacillus subtilis flagellin and zebrafish…
7MLM 2.1 Å, Crystal structure of mouse TLR4/MD-2 in complex with sulfatides
4QXE 2.2 Å, Crystal structure of LGR4 fused with hagfish VLR
4QXF 2.25 Å, crystal structure of human LGR4 and Rspo1
6BXA 2.3 Å, Crystal structure of N-terminal fragment of Zebrafish Toll-Like Receptor 5 (TLR5) with…
4BV4 2.35 Å, Structure and allostery in Toll-Spatzle recognition
3UL7 2.37 Å, Crystal structure of the TV3 mutant F63W
4QDH 2.4 Å, Crystal Structure of the C-terminal Domain of Mouse TLR9
3A7C 2.4 Å, Crystal structure of TLR2-PE-DTPA complex

Browse structure collections

About this viewer

MolViewer shows 2O6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.