2OD1: MYND domain from human AML1-ETO

Solution structure of the MYND domain from human AML1-ETO. Determined by solution NMR. Released 19 Jun 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 392
Mol. weight: 6.67 kDa
Ligands: ZN
Released: 19 Jun 2007

Explore 2OD1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OD1 contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	672-673	2	1
β-strand	681-682	2	1
α-helix	685-695	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein CBFA2T1	A	protein	60	Homo sapiens	Q06455 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OD1_1 Protein CBFA2T1 (chains A)
GSPNSGSPNSDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for recognition of SMRT/N-CoR by the MYND domain and its contribution to AML1/ETO's activity. Liu, Y., Chen, W., Gaudet, J. et al. Cancer Cell (2007) 11:483-497. DOI 10.1016/j.ccr.2007.04.010 · PubMed

Other PDB entries of the same protein (UniProt Q06455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WQ6 2.0 Å, The tetramer structure of the nervy homolgy two (NHR2) domain of AML1-ETO is critical…
4JOL 2.91 Å, Complex structure of AML1-ETO NHR2 domain with HEB fragment
2DJ8 Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8)
2H7B Solution structure of the eTAFH domain from the human leukemia-associated fusion protein…
2KNH The Solution structure of the eTAFH domain of AML1-ETO complexed with HEB peptide
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
2ODD Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor
2PP4 Solution Structure of ETO-TAFH refined in explicit solvent

Browse structure collections

About this viewer

MolViewer shows 2OD1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.