2ODE: PDB entry 2ODE

Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3. Determined by X-ray diffraction at 1.9 Å resolution. Released 6 Feb 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,749
Mol. weight: 114.7 kDa
Ligands: GDP, MG, ALF
Released: 6 Feb 2007

Explore 2ODE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ODE contains 57 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	1
α-helix	46-57	12
α-helix	63-68	6
α-helix	70-91	22
α-helix	100-110	11
α-helix	121-131	11
α-helix	134-141	8
α-helix	143-145	3
α-helix	152-157	6
α-helix	159-162	4
α-helix	171-175	5
β-strand	184-191	8	1
β-strand	194-201	8	1
α-helix	205-214	10
β-strand	220-226	7	1
α-helix	227-231	5
β-strand	233-234	2	2
β-strand	237-241	5	2
α-helix	242-254	13
α-helix	257-259	3
β-strand	263-269	7	1
α-helix	271-278	8
α-helix	283-285	3
α-helix	296-308	13
β-strand	319-323	5	1
α-helix	329-346	18

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	47-52	6
α-helix	57-61	5
α-helix	64-76	13
α-helix	80-92	13
α-helix	98-108	11
α-helix	109-113	5
α-helix	125-134	10
α-helix	144-153	10
α-helix	154-158	5
α-helix	159-164	6
α-helix	166-174	9

Chain C: 18 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	32-40	9	3
α-helix	46-57	12
α-helix	63-67	5
α-helix	70-91	22
α-helix	100-110	11
α-helix	121-131	11
α-helix	134-141	8
α-helix	143-145	3
α-helix	152-157	6
α-helix	159-162	4
α-helix	171-175	5
β-strand	184-191	8	3
β-strand	194-201	8	3
α-helix	205-214	10
β-strand	220-226	7	3
α-helix	227-231	5
β-strand	233	1	4
β-strand	241	1	4
α-helix	242-254	13
α-helix	257-259	3
β-strand	263-269	7	3
α-helix	271-277	7
α-helix	283-285	3
α-helix	296-308	13
β-strand	319-323	5	3
α-helix	329-345	17

Chain D: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	57-62	6
α-helix	64-76	13
α-helix	80-92	13
α-helix	98-108	11
α-helix	109-113	5
α-helix	125-134	10
α-helix	144-153	10
α-helix	154-158	5
α-helix	159-163	5
α-helix	166-170	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanine nucleotide-binding protein G(k) subunit alpha	A, C	protein	350	Homo sapiens	P08754 (AlphaFold model)
Regulator of G-protein signaling 8	B, D	protein	141	Homo sapiens	P57771 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2ODE_1 Guanine nucleotide-binding protein G(k) subunit alpha (chains A, C)
SMTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGY
SEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTP
ELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKT
TGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN
RMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAA
YIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKES

Sequence of entity 2 (B, D), FASTA

>2ODE_2 Regulator of G-protein signaling 8 (chains B, D)
SMLKRLSTEEATRWADSFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTA
KLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSY
PRFLRSKMYLDLLSQSQRRLS

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
MG	Magnesium ion	Mg	2
ALF	Tetrafluoroaluminate ion	Al F4	2

Primary citation

Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits. Soundararajan, M., Willard, F.S., Kimple, A.J. et al. Proc Natl Acad Sci U S A (2008) 105:6457-6462. DOI 10.1073/pnas.0801508105 · PubMed

Other PDB entries of the same protein (UniProt P08754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9YCX 2.1 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the…
9YCY 2.2 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the Canonical…
8IKL 2.33 Å, Cryo-EM structure of the CD97-G13 complex
8YK0 2.4 Å, Cryo-EM structure of human GPR156-Gi3 complex
7T10 2.5 Å, CryoEM structure of somatostatin receptor 2 in complex with somatostatin-14 and Gi3
9VJ6 2.62 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with F-15599
7T11 2.7 Å, CryoEM structure of somatostatin receptor 2 in complex with Octreotide and Gi3.
9VJF 2.7 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with buspirone
2IHB 2.71 Å, Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3
2V4Z 2.8 Å, The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an…
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
4G5O 2.9 Å, Structure of LGN GL4/Galphai3(Q147L) complex

Browse structure collections

About this viewer

MolViewer shows 2ODE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.