2OMU: InlA G194S+S Y369S/hEC1 complex

Crystal structure of InlA G194S+S Y369S/hEC1 complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Aug 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Listeria monocytogenes, Homo sapiens
Chains: 2
Atoms: 5,474
Mol. weight: 61.47 kDa
Ligands: CA
Released: 28 Aug 2007

Explore 2OMU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OMU contains 23 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	42-43	2	1
α-helix	44-47	4
α-helix	51-60	10
β-strand	69-70	2	1
α-helix	72-75	4
β-strand	80-82	3	2
α-helix	94-96	3
β-strand	102-104	3	2
α-helix	114-116	3
β-strand	124-126	3	2
α-helix	136-138	3
β-strand	146-148	3	2
α-helix	158-160	3
β-strand	168-170	3	2
α-helix	180-182	3
β-strand	190-192	3	2
α-helix	202-204	3
β-strand	212-214	3	2
α-helix	224-228	5
β-strand	234-236	3	2
α-helix	246-250	5
β-strand	256-258	3	2
α-helix	268-272	5
β-strand	278-280	3	2
α-helix	290-292	3
β-strand	300-302	3	2
α-helix	312-314	3
β-strand	322-324	3	2
α-helix	334-338	5
β-strand	344-346	3	2
α-helix	356-358	3
β-strand	366-368	3	2
α-helix	378-382	5
β-strand	388-390	3	2
β-strand	398	1	3
α-helix	400-402	3
β-strand	410-412	3	2
β-strand	416-419	4	4
α-helix	420-422	3
β-strand	423-424	2	5
β-strand	428-432	5	6
β-strand	436	1	3
α-helix	441	1
β-strand	442	1	3
α-helix	443-445	3
β-strand	447-448	2	4
α-helix	449-451	3
β-strand	453-455	3	6
β-strand	458-462	5	6
β-strand	469-480	12	4
β-strand	483-494	12	4
β-strand	495-496	2	5

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	7
β-strand	7-10	4	8
β-strand	19-23	5	9
β-strand	25-26	2	7
α-helix	27-30	4
β-strand	35-39	5	8
β-strand	41	1	10
β-strand	45	1	10
β-strand	51-53	3	9
β-strand	59-62	4	9
β-strand	73-81	9	8
β-strand	87	1	8
β-strand	92-99	8	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Internalin-A	A	protein	462	Listeria monocytogenes	P0DJM0 (AlphaFold model)
Epithelial-cadherin	B	protein	105	Homo sapiens	P12830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2OMU_1 Internalin-A (chains A)
ATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGVE
YLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQIT
DIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFSSNQVTDLKPLANLTTLERLDI
SSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTN
LTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISP
ISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFSNNKVSDVSSLANLTNINWLSAGHNQ
ISDLTPLANLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTGALIAPATISDGGSYT
EPDITWNLPSYTNEVSYTFSQPVTIGKGTTTFSGTVTQPLKA

Sequence of entity 2 (B), FASTA

>2OMU_2 Epithelial-cadherin (chains B)
GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERE
TGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin. Wollert, T., Heinz, D.W., Schubert, W.D. Proc Natl Acad Sci U S A (2007) 104:13960-13965. DOI 10.1073/pnas.0702199104 · PubMed

Other PDB entries of the same protein (UniProt P0DJM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1O6V 1.5 Å, Internalin (INLA, Listeria monocytogenes) - functional domain, uncomplexed
8H63 1.53 Å, Crystal structure of Internalin A from Listeria monocytogenes with nanobody VHH10 bound
1O6T 1.6 Å, Internalin (INLA, Listeria monocytogenes) - functional domain, uncomplexed
2OMZ 1.6 Å, Crystal structure of InlA Y369A/hEC1 complex
2OMY 1.7 Å, Crystal structure of InlA S192N/hEC1 complex
1O6S 1.8 Å, Internalin (Listeria monocytogenes) / E-Cadherin (human) Recognition Complex
2OMW 1.85 Å, Crystal structure of InlA S192N Y369S/mEC1 complex
2OMV 1.9 Å, Crystal structure of InlA S192N Y369S/hEC1 complex
8H62 1.91 Å, Crystal structure of Internalin A from Listeria monocytogenes with human E-cadherin EC12
8H64 2.35 Å, Crystal structure of Internalin A from Listeria monocytogenes with nanobody VHH24 bound

Browse structure collections

About this viewer

MolViewer shows 2OMU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.