2OO9: UBA domain from human c-Cbl ubiquitin ligase

Name: PDB 2OO9: crystal structure of the UBA domain from human c-Cbl ubiquitin ligase
Published: 2007-02-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

crystal structure of the UBA domain from human c-Cbl ubiquitin ligase. Determined by X-ray diffraction at 2.1 Å resolution. Released 6 Feb 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,092
Mol. weight: 15.52 kDa
Released: 6 Feb 2007

Explore 2OO9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OO9 contains 9 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	856-866	11
β-strand	869	1	1
α-helix	871-880	10
α-helix	885-895	11
β-strand	898	1	1

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	856-867	12
α-helix	871-880	10
α-helix	885-895	11

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	859-866	8
α-helix	871-880	10
α-helix	885-895	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CBL	A, B, C	protein	46	Homo sapiens	P22681 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2OO9_1 E3 ubiquitin-protein ligase CBL (chains A, B, C)
GSQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFAAAS

Primary citation

Structural basis for UBA-mediated dimerization of c-Cbl ubiquitin ligase. Kozlov, G., Peschard, P., Zimmerman, B. et al. J Biol Chem (2007) 282:27547-27555. DOI 10.1074/jbc.M703333200 · PubMed

Other PDB entries of the same protein (UniProt P22681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BUX 1.35 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in c-Met
3BUW 1.45 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Syk
7SIY 1.48 Å, cCBL TKB domain in complex with pZAP70 peptide
5HKY 1.8 Å, Crystal structure of c-Cbl TKBD domain in complex with SPRY2 peptide (36-60, pY55)…
5HKZ 1.8 Å, Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to…
5HKX 1.85 Å, Crystal Structure of c-Cbl TKBD-RING domains (Y371E mutant) Refined to 1.85 A Resolution
3PLF 1.92 Å, Reverse Binding Mode of MetRD peptide complexed with c-Cbl TKB domain
2Y1N 2.0 Å, Structure of c-Cbl-ZAP-70 peptide complex
3BUM 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty2
3BUN 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty4
9ERZ 2.02 Å, Structure of CBL-TKBD bound to Ubiquitin-fused CBLock peptide
1YVH 2.05 Å, Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 2OO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.