2PP4: ETO-TAFH refined in explicit solvent

Name: PDB 2PP4: Solution Structure of ETO-TAFH refined in explicit solvent
Published: 2007-06-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution Structure of ETO-TAFH refined in explicit solvent. Determined by solution NMR. Released 19 Jun 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 854
Mol. weight: 12.14 kDa
Released: 19 Jun 2007

Explore 2PP4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PP4 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	120-140	21
α-helix	144-156	13
α-helix	162-173	12
α-helix	181-203	23
α-helix	207-217	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein ETO	A	protein	107	Homo sapiens	Q06455 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2PP4_1 Protein ETO (chains A)
GARQLSKLKRFLTTLQQYGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLR
PFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTS

Primary citation

A TAF4-homology domain from the corepressor ETO is a docking platform for positive and negative regulators of transcription. Wei, Y., Liu, S., Lausen, J. et al. Nat Struct Mol Biol (2007) 14:653-661. DOI 10.1038/nsmb1258 · PubMed

Other PDB entries of the same protein (UniProt Q06455 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WQ6 2.0 Å, The tetramer structure of the nervy homolgy two (NHR2) domain of AML1-ETO is critical…
4JOL 2.91 Å, Complex structure of AML1-ETO NHR2 domain with HEB fragment
2DJ8 Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8)
2H7B Solution structure of the eTAFH domain from the human leukemia-associated fusion protein…
2KNH The Solution structure of the eTAFH domain of AML1-ETO complexed with HEB peptide
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
2OD1 Solution structure of the MYND domain from human AML1-ETO
2ODD Solution structure of the MYND domain from AML1-ETO complexed with SMRT, a corepressor

Browse structure collections

About this viewer

MolViewer shows 2PP4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.