2PVY: Fibroblast growth factor receptor 2

Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Pathogenic K659N Mutation Responsible for an Unclassified Craniosynostosis Syndrome. Determined by X-ray diffraction at 2.2 Å resolution. Released 25 Sept 2007.

Method

X-ray diffraction

Resolution

2.2 Å

Organism

Homo sapiens

Chains

4

Atoms

9,429

Mol. weight

150.79 kDa

Ligands

ACP

Released

25 Sept 2007

Explore 2PVY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PVY contains 74 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 16 β-strands

Molecules and chains

>2PVY_1 Fibroblast growth factor receptor 2 (chains A, B, C, D)
MGSSHHHHHHSQDPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGID
KDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIV
EYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIH
RDLAARNVLVTENNVMKIADFGLARDINNIDYYKNTTNGRLPVKWMAPEALFDRVYTHQS
DVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVP
SQRPTFKQLVEDLDRILTLTTNEE

Ligands and cofactors

Water and common crystallization additives (SO4) are not listed.

Primary citation

A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases. Chen, H., Ma, J., Li, W. et al. Mol Cell (2007) 27:717-730. DOI 10.1016/j.molcel.2007.06.028 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P21802 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 10OU 1.77 Å, FGFR2 mutant D650V with compound 12
• 2PVF 1.8 Å, Crystal Structure of Tyrosine Phosphorylated Activated FGF Receptor 2 (FGFR2) Kinase…
• 3B2T 1.8 Å, Structure of phosphotransferase
• 4J99 1.85 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domain Harboring the Gain-of-Function…
• 10OO 1.85 Å, FGFR2 mutant D650V with compound 4 (AZD3463)
• 5UGL 1.86 Å, Crystal Structure of FGF Receptor 2 Tyrosine Kinase Domain Harboring the D650V…
• 3CAF 1.96 Å, Crystal Structure of hFGFR2 D2 Domain
• 10OQ 1.98 Å, FGFR2 mutant D650V with compound 6
• 9U7S 1.99 Å, FGFR2 kinase domain with a macrocyclic compound 8r
• 3CLY 2.0 Å, Crystal Structure of FGF Receptor 2 (FGFR2) Kinase Domains Trapped in…
• 8W3D 2.04 Å, TAS-120 covalent structure with FGFR2 molecular brake mutant
• 5UI0 2.05 Å, Crystal Structure of the Tyrosine Kinase Domain of FGF Receptor 2 harboring an…

Browse structure collections

About this viewer

MolViewer shows 2PVY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.