2PZD: HtrA2/Omi PDZ Domain

Crystal Structure of the HtrA2/Omi PDZ Domain Bound to a Phage-Derived Ligand (WTMFWV). Determined by X-ray diffraction at 2.75 Å resolution. Released 7 Aug 2007.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,695
Mol. weight: 25.31 kDa
Released: 7 Aug 2007

Explore 2PZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2PZD contains 6 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	360-361	2	1
β-strand	364-368	5	2
α-helix	371-380	10
β-strand	391-396	6	2
β-strand	397	1	3
α-helix	401-405	5
β-strand	412-416	5	2
β-strand	419-420	2	2
α-helix	424-433	10
β-strand	437-443	7	2
β-strand	446-452	7	2
β-strand	455-456	2	1
β-strand	465-466	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine protease HTRA2	A, B	protein	113	Homo sapiens	O43464 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2PZD_1 Serine protease HTRA2 (chains A, B)
GSHMRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVIL
AIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTEGGGWTMFWV

Primary citation

Structural and functional analysis of the ligand specificity of the HtrA2/Omi PDZ domain. Zhang, Y., Appleton, B.A., Wu, P. et al. Protein Sci (2007) 16:1738-1750. DOI 10.1110/ps.072833207 · PubMed

Other PDB entries of the same protein (UniProt O43464 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M3N 1.65 Å, HTRA2 wild-type structure
5TO1 1.69 Å, HtrA2 exposed (L266R, F303A) mutant
5M3O 1.7 Å, HTRA2 A141S mutant structure
5TNY 1.7 Å, HTRA2 G399S mutant
5TNZ 1.75 Å, HtrA2 S142D mutant
5TO0 1.9 Å, HTRA2 S276C mutant
5FHT 1.95 Å, HtrA2 protease mutant V226K
1LCY 2.0 Å, Crystal Structure of the Mitochondrial Serine Protease HtrA2
5WYN 2.05 Å, HtrA2 Pathogenic Mutant
8E2K 3.21 Å, Cryo-EM structure of BIRC6/HtrA2-S306A
7VGE 4.0 Å, Structure of the PDZ deleted variant of HtrA2 protease (S306A)
8AUK 6.2 Å, Cryo-EM structure of human BIRC6 in complex with HTRA2.

Browse structure collections

About this viewer

MolViewer shows 2PZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.