2Q0Z: Protein PRO2281

Crystal structure of Q9P172/Sec63 from Homo sapiens. Northeast Structural Genomics Target HR1979. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Jun 2007.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,574
Mol. weight: 39.09 kDa
Released: 5 Jun 2007

Explore 2Q0Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Q0Z contains 12 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	35-43	9
α-helix	46-48	3
α-helix	58-67	10
α-helix	80-92	13
α-helix	99-125	27
β-strand	128	1	1
α-helix	129-144	16
α-helix	152-155	4
α-helix	161-169	9
α-helix	175-180	6
α-helix	183-190	8
α-helix	194-204	11
β-strand	210-216	7	2
α-helix	219-221	3
β-strand	223	1	3
β-strand	227-236	10	2
β-strand	257-263	7	1
β-strand	268-275	8	1
β-strand	280-288	9	2
β-strand	293-303	11	1
β-strand	311-319	9	1
β-strand	320	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein PRO2281	X	protein	339	Homo sapiens	O75643 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>2Q0Z_1 Protein PRO2281 (chains X)
MGHHHHHHSHMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYEN
IPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILS
KAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDK
GVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVV
LVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAP
ATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Primary citation

Crystal structure of Q9P172/Sec63 from Homo sapiens. Benach, J., Neely, H., Abashidze, M. et al. To be published.

Other PDB entries of the same protein (UniProt O75643 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8BCE 2.05 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 76
8BC9 2.3 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 24
8BCC 2.35 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 39
8BCB 2.38 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 34
8BC8 2.39 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 18
8BCG 2.39 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 86
6S8Q 2.39 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1
9S2E 2.4 Å, Human intron-lariat spliceosome-Aquarius (ILSaqr)
8BCF 2.42 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and compound 78
7BDK 2.52 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and ADP
7BDJ 2.59 Å, Human Brr2 Helicase Region in complex with C-tail deleted Jab1 and mant-ATPgammaS
6S9I 2.6 Å, Human Brr2 Helicase Region D534C/N1866C in complex with C-tail deleted Jab1

Browse structure collections

About this viewer

MolViewer shows 2Q0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.