Structure of FTSY:GMPPNP Complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 3 Jul 2007.
Explore 2Q9B in 3D Show helices and sheets RCSB PDB PDBe
2Q9B contains 37 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-10 | 7 | |
| α-helix | 12-16 | 5 | |
| α-helix | 19-21 | 3 | |
| α-helix | 28-41 | 14 | |
| α-helix | 46-54 | 9 | |
| α-helix | 55-59 | 5 | |
| α-helix | 64-75 | 12 | |
| α-helix | 80-88 | 9 | |
| α-helix | 95-98 | 4 | |
| β-strand | 104-108 | 5 | 1 |
| α-helix | 115-128 | 14 | |
| β-strand | 133-137 | 5 | 1 |
| α-helix | 149-156 | 8 | |
| β-strand | 160-161 | 2 | 1 |
| α-helix | 169-182 | 14 | |
| β-strand | 187-191 | 5 | 1 |
| α-helix | 202-216 | 15 | |
| β-strand | 223-229 | 7 | 1 |
| α-helix | 230-232 | 3 | |
| α-helix | 234-247 | 14 | |
| β-strand | 251-255 | 5 | 1 |
| α-helix | 257-259 | 3 | |
| α-helix | 263-265 | 3 | |
| α-helix | 266-273 | 8 | |
| β-strand | 277-281 | 5 | 1 |
| α-helix | 286-288 | 3 | |
| β-strand | 289-291 | 3 | 1 |
| α-helix | 292 | 1 | |
| α-helix | 294-302 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-16 | 13 | |
| α-helix | 19-21 | 3 | |
| α-helix | 31-41 | 11 | |
| α-helix | 46-57 | 12 | |
| α-helix | 65-75 | 11 | |
| β-strand | 104-108 | 5 | 2 |
| α-helix | 115-127 | 13 | |
| β-strand | 133-136 | 4 | 2 |
| α-helix | 144-156 | 13 | |
| β-strand | 160-161 | 2 | 2 |
| α-helix | 169-182 | 14 | |
| β-strand | 187-190 | 4 | 2 |
| α-helix | 202-216 | 15 | |
| β-strand | 223-229 | 7 | 2 |
| α-helix | 230-232 | 3 | |
| α-helix | 236-247 | 12 | |
| β-strand | 251-255 | 5 | 2 |
| α-helix | 263-265 | 3 | |
| α-helix | 266-273 | 8 | |
| β-strand | 277-281 | 5 | 2 |
| α-helix | 286-288 | 3 | |
| β-strand | 289-291 | 3 | 2 |
| α-helix | 292 | 1 | |
| α-helix | 294-302 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cell division protein ftsY | A, B | protein | 304 | Thermus aquaticus | P83749 (AlphaFold model) |
>2Q9B_1 Cell division protein ftsY (chains A, B) MGFFDRLKAGLAKTRERLLKAIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASG RKDLKEAVKEKLVGMLEPDERRATLRKLGFNPQKPKPVEPKGRVVLVVGVNGVGKTTTIA KLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAM KARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQA KKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEA LLED
| ID | Name | Formula | Copies |
|---|---|---|---|
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 1 |
Water and common crystallization additives (EDO, SO4) are not listed.
X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates. Reyes, C.L., Rutenber, E., Walter, P. et al. PLoS One (2007) 2:e607-e607. DOI 10.1371/journal.pone.0000607 · PubMed
Other PDB entries of the same protein (UniProt P83749 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Q9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.