Crystal structure of the C890S mutant of the 4th PDZ domain of human membrane associated guanylate kinase. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Jun 2007.
Explore 2Q9V in 3D Show helices and sheets RCSB PDB PDBe
2Q9V contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 838-845 | 8 | 1 |
| β-strand | 847 | 1 | 2 |
| β-strand | 850 | 1 | 2 |
| β-strand | 853-857 | 5 | 1 |
| β-strand | 865-870 | 6 | 1 |
| α-helix | 875-879 | 5 | |
| α-helix | 886 | 1 | |
| β-strand | 887-891 | 5 | 1 |
| β-strand | 894-895 | 2 | 1 |
| α-helix | 901-914 | 14 | |
| β-strand | 916-923 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 | A | protein | 90 | Homo sapiens | Q96QZ7 (AlphaFold model) |
>2Q9V_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (chains A) SMEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELISVDGTPV IGKSHQLVVQLMQQAAKQGHVNLTVRQTRL
Crystal structure of the C890S mutant of the 4th PDZ domain of human membrane associated guanylate kinase. Pilka, E.S., Hozjan, V., Kavanagh, K.L. et al. To be published.
Other PDB entries of the same protein (UniProt Q96QZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Q9V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.