2QKH: Extracellular domain of human GIP receptor

Crystal structure of the extracellular domain of human GIP receptor in complex with the hormone GIP. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Aug 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,250
Mol. weight: 21.78 kDa
Ligands: TAR
Released: 14 Aug 2007

Explore 2QKH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2QKH contains 7 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	32-52	21
α-helix	53-56	4
β-strand	61	1	1
α-helix	62-63	2
β-strand	64-65	2	2
β-strand	70-71	2	2
β-strand	74	1	1
β-strand	78-83	6	3
α-helix	91-94	4
β-strand	98-103	6	3
α-helix	104	1
β-strand	109	1	3
β-strand	114	1	3
α-helix	116-118	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-28	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-dependent insulinotropic polypeptide	B	protein	42		P09681 (AlphaFold model)
Glucose-dependent insulinotropic polypeptide receptor	A	protein	135	Homo sapiens	P48546 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>2QKH_1 Glucose-dependent insulinotropic polypeptide (chains B)
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Sequence of entity 2 (A), FASTA

>2QKH_2 Glucose-dependent insulinotropic polypeptide receptor (chains A)
GSSHHHHHHSSGLVPRGSHMETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNG
SFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEK
NEAFLDQRLILERLQ

Ligands and cofactors

ID	Name	Formula	Copies
TAR	D(-)-tartaric acid	C4 H6 O6	1

Primary citation

Crystal structure of the incretin-bound extracellular domain of a G protein-coupled receptor. Parthier, C., Kleinschmidt, M., Neumann, P. et al. Proc Natl Acad Sci U S A (2007) 104:13942-13947. DOI 10.1073/pnas.0706404104 · PubMed

Other PDB entries of the same protein (UniProt P09681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DTY 2.98 Å, Structural basis of ligand selectivity conferred by the human glucose-dependent…
7RA3 3.24 Å, cryo-EM of human Gastric inhibitory polypeptide receptor GIPR bound to GIP
1T5Q Solution Structure of GIP(1-30)amide in TFE/Water
2B4N Solution Structure of Glucose-Dependent Insulinotropic Polypeptide
2L70 NMR solution structure of GIP in micellular media
2L71 NMR solution structure of GIP in Bicellular media
2OBU Solution structure of GIP in TFE/water

Browse structure collections

About this viewer

MolViewer shows 2QKH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.