2R1Z: BARD1 BRCT Repeat

Crystal Structure of the BARD1 BRCT Repeat. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 Sept 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,439
Mol. weight: 48.28 kDa
Released: 4 Sept 2007

Explore 2R1Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R1Z contains 20 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	571-574	4	1
α-helix	579-592	14
β-strand	595-597	3	1
β-strand	606-608	3	1
α-helix	618-625	8
β-strand	629-631	3	1
α-helix	634-642	9
α-helix	648-650	3
β-strand	652	1	1
α-helix	656-665	10
α-helix	668-670	3
β-strand	676-679	4	2
α-helix	688-697	10
β-strand	701-702	2	2
α-helix	712-715	4
α-helix	729-731	3
β-strand	735-739	5	2
β-strand	751-752	2	2
β-strand	755-759	5	2
α-helix	760-769	10

Chain B: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	571-574	4	3
α-helix	579-591	13
β-strand	595-597	3	3
β-strand	606-609	4	3
α-helix	618-625	8
β-strand	629-632	4	3
α-helix	634-642	9
α-helix	648-651	4
β-strand	652	1	3
α-helix	656-665	10
α-helix	668-670	3
β-strand	676-679	4	4
α-helix	688-697	10
β-strand	701-702	2	4
α-helix	712-716	5
α-helix	729-731	3
β-strand	735-739	5	4
β-strand	751-752	2	4
β-strand	755-759	5	4
α-helix	760-769	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRCA1-associated RING domain protein 1	A, B	protein	209	Homo sapiens	Q99728 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2R1Z_1 BRCA1-associated RING domain protein 1 (chains A, B)
PLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTVTHVVVPGDAVQSTLKCMLGILNGC
WILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNREQLLPKLFDGCYFYLWGTFKHHPK
DNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPE
RVRQGKVWKAPSSWFIDCVMSFELLPLDS

Primary citation

Crystal Structure of the BARD1 BRCT Repeat. Lee, M.S., Edwards, R.A., Tsutakawa, S.E. et al. To be published.

Other PDB entries of the same protein (UniProt Q99728 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6M14 1.88 Å, Crystal Structure of the BARD1 BRCT Mutant
2NTE 1.9 Å, Crystal Structure of the BARD1 BRCT Domains
3C5R 2.0 Å, Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences
3FA2 2.2 Å, Crystal Structure of the BRCA1 Associated Ring Domain (BARD1) Tandem BRCT Domains
7LYC 2.94 Å, Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A…
7E8I 3.1 Å, Structural insight into BRCA1-BARD1 complex recruitment to damaged chromatin
7LYB 3.28 Å, Cryo-EM structure of the human nucleosome core particle in complex with BRCA1-BARD1-UbcH5c
8GRQ 3.87 Å, Cryo-EM structure of BRCA1/BARD1 bound to H2AK127-UbcH5c-Ub nucleosome
7JZV 3.9 Å, Cryo-EM structure of the BRCA1-UbcH5c/BARD1 E3-E2 module bound to a nucleosome
1JM7 Solution structure of the BRCA1/BARD1 RING-domain heterodimer

Browse structure collections

About this viewer

MolViewer shows 2R1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.