3C5R: BRCA1-associated RING domain protein 1

Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 May 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,176
Mol. weight: 29.95 kDa
Released: 13 May 2008

Explore 3C5R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3C5R contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	431-438	8
α-helix	441-449	9
α-helix	464-470	7
α-helix	474-482	9
α-helix	492-494	3
α-helix	497-503	7
α-helix	507-515	9
α-helix	530-533	4
α-helix	537-543	7

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	431-438	8
α-helix	441-449	9
α-helix	464-471	8
α-helix	474-482	9
α-helix	492-494	3
α-helix	497-503	7
α-helix	507-515	9
α-helix	530-533	4
α-helix	537-543	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRCA1-associated RING domain protein 1	A, B	protein	137	Homo sapiens	Q99728 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3C5R_1 BRCA1-associated RING domain protein 1 (chains A, B)
GIDPFTNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVE
LLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDES
MKSLLLLPEKNESSSAS

Primary citation

Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences. Fox, D., Le Trong, I., Rajagopal, P. et al. J Biol Chem (2008) 283:21179-21186. DOI 10.1074/jbc.M802333200 · PubMed

Other PDB entries of the same protein (UniProt Q99728 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6M14 1.88 Å, Crystal Structure of the BARD1 BRCT Mutant
2NTE 1.9 Å, Crystal Structure of the BARD1 BRCT Domains
2R1Z 2.1 Å, Crystal Structure of the BARD1 BRCT Repeat
3FA2 2.2 Å, Crystal Structure of the BRCA1 Associated Ring Domain (BARD1) Tandem BRCT Domains
7LYC 2.94 Å, Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A…
7E8I 3.1 Å, Structural insight into BRCA1-BARD1 complex recruitment to damaged chromatin
7LYB 3.28 Å, Cryo-EM structure of the human nucleosome core particle in complex with BRCA1-BARD1-UbcH5c
8GRQ 3.87 Å, Cryo-EM structure of BRCA1/BARD1 bound to H2AK127-UbcH5c-Ub nucleosome
7JZV 3.9 Å, Cryo-EM structure of the BRCA1-UbcH5c/BARD1 E3-E2 module bound to a nucleosome
1JM7 Solution structure of the BRCA1/BARD1 RING-domain heterodimer

Browse structure collections

About this viewer

MolViewer shows 3C5R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.