2R83: Synaptotagmin-1

Crystal structure analysis of human synaptotagmin 1 C2A-C2B. Determined by X-ray diffraction at 2.7 Å resolution. Released 12 Feb 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,563
Mol. weight: 65.35 kDa
Released: 12 Feb 2008

Explore 2R83 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2R83 contains 16 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	144-152	9	1
β-strand	157-166	10	1
α-helix	168-171	4
β-strand	179-186	8	2
β-strand	193-194	2	2
α-helix	195-199	5
β-strand	205-212	8	1
α-helix	216-218	3
β-strand	223-230	8	2
β-strand	239-246	8	2
α-helix	247-249	3
β-strand	256-261	6	1
β-strand	263	1	2
β-strand	275-283	9	3
β-strand	288-297	10	3
α-helix	299-301	3
β-strand	310-318	9	4
β-strand	321-327	7	4
β-strand	338-346	9	3
α-helix	352-354	3
β-strand	355-363	9	4
β-strand	372-379	8	4
α-helix	384-395	12
α-helix	400	1
β-strand	401-406	6	3
β-strand	408	1	4
α-helix	410-417	8

Chain B: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	144-152	9	5
β-strand	157-166	10	5
β-strand	179-186	8	6
β-strand	193-194	2	6
α-helix	195-199	5
β-strand	205-212	8	5
α-helix	216-218	3
β-strand	223-230	8	6
β-strand	239-246	8	6
α-helix	247-249	3
β-strand	256-261	6	5
β-strand	263	1	6
β-strand	275-283	9	7
β-strand	288-297	10	7
α-helix	299-301	3
β-strand	310-318	9	8
β-strand	321-327	7	8
β-strand	338-346	9	7
α-helix	352-354	3
β-strand	355-363	9	8
β-strand	372-379	8	8
α-helix	384-395	12
β-strand	401-406	6	7
β-strand	408	1	8
α-helix	410-417	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptotagmin-1	A, B	protein	284	Homo sapiens	P21579 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2R83_1 Synaptotagmin-1 (chains A, B)
GSEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKV
HRKTLNPVFNEQFTFKVPYSELAGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTE
EWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLM
QNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVF
VGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Primary citation

Structure of human synaptotagmin 1 C2AB in the absence of Ca2+ reveals a novel domain association. Fuson, K.L., Montes, M., Robert, J.J. et al. Biochemistry (2007) 46:13041-13048. DOI 10.1021/bi701651k · PubMed

Other PDB entries of the same protein (UniProt P21579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TZ3 1.17 Å, Crystal Structure of Human Synaptotagmin 1 C2B without Ca2+
6U4U 1.3 Å, 1.3 A structure of a pathogenic human Syt 1 C2B (I368T)
3F04 1.35 Å, Crystal Structure of Synaptotagmin I C2A domain
7TUA 1.35 Å, Human Synaptotagmin-1 C2B Y312F without Ca2+
3F00 1.36 Å, Crystal Structure of Synaptotagmin I C2A domain with Cu(II)
3F05 1.4 Å, Crystal Structure of Synaptotagmin I C2A domain with Mn(II)
6U4W 1.4 Å, 1.4 A structure of a pathogenic human Syt 1 C2B (D366E)
7U4Q 1.56 Å, Human Synaptotagmin-1 C2A Y181F Ca2+ bound
3F01 1.7 Å, Crystal Structure of Synaptotagmin I C2A domain with Cu(II)
6U41 1.7 Å, 1.7 angstrom structure of a pathogenic human Syt 1 C2B (D304G)
4V11 1.95 Å, Structure of Synaptotagmin-1 with SV2A peptide phosphorylated at Thr84
6G5K 2.0 Å, Crystal structure of the binding domain of Botulinum Neurotoxin type B in complex with…

Browse structure collections

About this viewer

MolViewer shows 2R83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.