2RI7: Nucleosome-remodeling factor subunit BPTF

Crystal structure of PHD finger-linker-bromodomain Y17E mutant from human BPTF in the H3(1-9)K4ME2 bound state. Determined by X-ray diffraction at 1.45 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,808
Mol. weight: 21.64 kDa
Ligands: IPA, ZN
Released: 11 Dec 2007

Explore 2RI7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RI7 contains 10 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	1
β-strand	15-16	2	1
β-strand	23-25	3	2
β-strand	32-34	3	2
α-helix	35-38	4
α-helix	42-45	4
α-helix	54-63	10
β-strand	68	1	3
α-helix	69	1
α-helix	71-85	15
α-helix	88-90	3
α-helix	103-108	6
α-helix	115-123	9
β-strand	129	1	3
α-helix	130-147	18
α-helix	153-168	16

Chain P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleosome-remodeling factor subunit BPTF	A	protein	174	Homo sapiens	Q12830
histone H3.1	P	protein	9		P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RI7_1 Nucleosome-remodeling factor subunit BPTF (chains A)
GPLGSDTKLYCICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTE
DAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEE
RVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKA

Sequence of entity 2 (P), FASTA

>2RI7_2 histone H3.1 (chains P)
ARTKQTARK

Ligands and cofactors

ID	Name	Formula	Copies
IPA	Isopropyl alcohol	C3 H8 O	1
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger. Li, H., Fischle, W., Wang, W. et al. Mol Cell (2007) 28:677-691. DOI 10.1016/j.molcel.2007.10.023 · PubMed

Other PDB entries of the same protein (UniProt Q12830), best resolution first:

8AG2 1.02 Å, Crystal structure of the BPTF bromodomain in complex with BI-7190
5R4O 1.05 Å, PanDDA analysis group deposition of ground-state model of BROMODOMAIN OF HUMAN…
5R4M 1.11 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4L 1.13 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4K 1.17 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4H 1.18 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
7K6S 1.23 Å, Crystal structure of the bromodomain (BD) of human Bromodomain and PHD finger-containing…
5R4G 1.25 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4I 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4N 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
9ZUK 1.35 Å, Crystal structure of BPTF bromodomain bound to BZ1
5R4J 1.39 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…

Browse structure collections

About this viewer

MolViewer shows 2RI7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.