Solution structure of mSin3A PAH1 domain. Determined by solution NMR. Released 22 Jan 2008.
Explore 2RMR in 3D Show helices and sheets RCSB PDB PDBe
2RMR contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 126-136 | 11 | |
| α-helix | 141-155 | 15 | |
| α-helix | 161-171 | 11 | |
| α-helix | 176-183 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Paired amphipathic helix protein Sin3a | A | protein | 71 | Mus musculus | Q60520 (AlphaFold model) |
>2RMR_1 Paired amphipathic helix protein Sin3a (chains A) QRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDL IMGFNTFLPPG
Conserved Themes in Target Recognition by the PAH1 and PAH2 Domains of the Sin3 Transcriptional Corepressor. Sahu, S.C., Swanson, K.A., Kang, R.S. et al. J Mol Biol (2007) 375:1444-1456. DOI 10.1016/j.jmb.2007.11.079 · PubMed
Other PDB entries of the same protein (UniProt Q60520 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2RMR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.