2RMS: MSin3A PAH1-SAP25 SID complex

Name: PDB 2RMS: Solution structure of the mSin3A PAH1-SAP25 SID complex
Published: 2008-01-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of the mSin3A PAH1-SAP25 SID complex. Determined by solution NMR. Released 22 Jan 2008.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 995
Mol. weight: 14.23 kDa
Released: 22 Jan 2008

Explore 2RMS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RMS contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	123-136	14
α-helix	137-139	3
α-helix	141-156	16
α-helix	161-171	11
α-helix	176-182	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	132-144	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Paired amphipathic helix protein Sin3a	A	protein	71	Mus musculus	Q60520 (AlphaFold model)
MSin3A-binding protein	B	protein	61	Mus musculus	Q1EHW4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RMS_1 Paired amphipathic helix protein Sin3a (chains A)
QRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDL
IMGFNTFLPPG

Sequence of entity 2 (B), FASTA

>2RMS_2 MSin3A-binding protein (chains B)
SSTWLSEAEMIALAGLLQMSQGEQTPNCVASSLPSTSCPDPVSVSEDPGPSGDQSCSGTD
T

Primary citation

Conserved Themes in Target Recognition by the PAH1 and PAH2 Domains of the Sin3 Transcriptional Corepressor. Sahu, S.C., Swanson, K.A., Kang, R.S. et al. J Mol Biol (2007) 375:1444-1456. DOI 10.1016/j.jmb.2007.11.079 · PubMed

Other PDB entries of the same protein (UniProt Q60520 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G1E NMR structure of the human MAD1 transrepression domain sid in complex with mammalian…
1S5Q Solution Structure of Mad1 SID-mSin3A PAH2 Complex
1S5R Solution Structure of HBP1 SID-mSin3A PAH2 Complex
2L9S Solution structure of Pf1 SID1-mSin3A PAH2 Complex
2LD7 Solution structure of the mSin3A PAH3-SAP30 SID complex
2N2H Solution structure of Sds3 in complex with Sin3A
2RMR Solution structure of mSin3A PAH1 domain

Browse structure collections

About this viewer

MolViewer shows 2RMS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.