2RQB: MDA5 CTD

Solution structure of MDA5 CTD. Determined by solution NMR. Released 5 May 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,081
Mol. weight: 15.57 kDa
Ligands: ZN
Released: 5 May 2009

Explore 2RQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RQB contains 4 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	903-907	5	1
β-strand	915-916	2	1
β-strand	921-923	3	2
β-strand	927-929	3	2
α-helix	934-937	4
β-strand	940-942	3	3
β-strand	955-956	2	4
β-strand	959-961	3	3
β-strand	967	1	3
β-strand	969-973	5	4
β-strand	979-982	4	4
α-helix	984-986	3
β-strand	987-991	5	1
β-strand	996-998	3	1
α-helix	1003-1005	3
α-helix	1015-1017	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-induced helicase C domain-containing protein 1	A	protein	135	Homo sapiens	Q9BYX4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RQB_1 Interferon-induced helicase C domain-containing protein 1 (chains A)
GPLGSYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKK
CADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITF
PNLDYSECCLFSDED

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution Structures of Cytosolic RNA Sensor MDA5 and LGP2 C-terminal Domains: IDENTIFICATION OF THE RNA RECOGNITION LOOP IN RIG-I-LIKE RECEPTORS. Takahasi, K., Kumeta, H., Tsuduki, N. et al. J Biol Chem (2009) 284:17465-17474. DOI 10.1074/jbc.M109.007179 · PubMed

Other PDB entries of the same protein (UniProt Q9BYX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GA3 1.45 Å, Crystal structure of the C-terminal domain of human MDA5
3B6E 1.6 Å, Crystal structure of human DECH-box RNA Helicase MDA5 (Melanoma…
9Y4J 2.81 Å, CryoEM Structure of human MDA5 with dsRNA (one protein subunit on dsRNA)
9Y4L 2.96 Å, CryoEM Structure of human MDA5 in complex with dsRNA (two protein subunits on dsRNA)
9LOV 3.07 Å, LGP2:MDA5:dsRNA filament
9Q60 3.12 Å, CryoEM Structure of human MDA5 disease-linked mutant T331I with dsRNA (one protein…
7DNI 3.2 Å, MDA5 CARDs-MAVS CARD polyUb complex
9Q5W 3.21 Å, CryoEM Structure of human MDA5 T331I mutant in complex with dsRNA
7DNJ 3.3 Å, K63-polyUb MDA5CARDs complex
4GL2 3.56 Å, Structural Basis for dsRNA duplex backbone recognition by MDA5
7JL0 4.3 Å, Cryo-EM structure of MDA5-dsRNA in complex with TRIM65 PSpry domain (Monomer)
7JL2 4.3 Å, Cryo-EM structure of MDA5-dsRNA filament in complex with TRIM65 PSpry domain (Trimer)

Browse structure collections

About this viewer

MolViewer shows 2RQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.