2VJ3: Human Notch-1 EGFs 11-13

Human Notch-1 EGFs 11-13. Determined by X-ray diffraction at 2.6 Å resolution. Released 29 Jul 2008.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 928
Mol. weight: 15.13 kDa
Ligands: CA
Released: 29 Jul 2008

Explore 2VJ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VJ3 contains 4 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	427	1
β-strand	428-431	4	1
β-strand	436-439	4	1
α-helix	440-441	2
β-strand	444-445	2	2
β-strand	451-452	2	2
α-helix	465	1
β-strand	466-469	4	3
β-strand	474-477	4	3
β-strand	482-483	2	4
β-strand	489-490	2	4
α-helix	503	1
β-strand	504-507	4	5
β-strand	512-515	4	5
β-strand	520-521	2	6
β-strand	527-528	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurogenic locus notch homolog protein 1	A	protein	135	HOMO SAPIENS	P46531 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VJ3_1 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1 (chains A)
SAQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCL
DQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVD
LHHILDAQKMVWNHR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (NA, CL) are not listed.

Primary citation

A Conserved Face of the Jagged/Serrate Dsl Domain is Involved in Notch Trans-Activation and Cis-Inhibition. Cordle, J., Johnson, S., Tay, J.Z. et al. Nat Struct Mol Biol (2008) 15:849. DOI 10.1038/NSMB.1457 · PubMed

Other PDB entries of the same protein (UniProt P46531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5L0R 1.5 Å, human POGLUT1 in complex with Notch1 EGF12 and UDP
9B3N 1.5 Å, Human Notch-1 EGFs 20-24
2F8Y 1.55 Å, Crystal structure of human Notch1 ankyrin repeats to 1.55A resolution.
9B3G 1.55 Å, Human Notch-1 EGFs 21-23
4D0E 1.61 Å, Human Notch1 EGF domains 11-13 mutant GlcNAc-fucose disaccharide modified at T466
4CUD 1.85 Å, Human Notch1 EGF domains 11-13 mutant fucosylated at T466
2HE0 1.9 Å, Crystal structure of a human Notch1 ankyrin domain mutant
1YYH 1.9 Å, Crystal structure of the human Notch 1 ankyrin domain
3ETO 2.0 Å, 2 Angstrom Xray structure of the NOTCH1 Negative Regulatory Region (NRR)
5UB5 2.09 Å, human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP
3L95 2.19 Å, Crystal structure of the human Notch1 Negative Regulatory Region (NRR) bound to the fab…
4CUF 2.29 Å, Human Notch1 EGF domains 11-13 mutant T466S

Browse structure collections

About this viewer

MolViewer shows 2VJ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.