2VOF: Mouse A1

Structure of mouse A1 bound to the Puma BH3-domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Mar 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: MUS MUSCULUS
Chains: 4
Atoms: 2,900
Mol. weight: 42.68 kDa
Released: 4 Mar 2008

Explore 2VOF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VOF contains 19 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	1-21	21
α-helix	32-51	20
α-helix	53-56	4
α-helix	64-79	16
α-helix	86-105	20
α-helix	114-136	23
α-helix	139-144	6
α-helix	145-147	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	132-151	20

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	1-21	21
α-helix	23-25	3
α-helix	32-51	20
α-helix	53-56	4
α-helix	64-79	16
α-helix	86-106	21
α-helix	114-136	23
α-helix	139-145	7
α-helix	146-148	3

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	133-151	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-related protein A1	A, C	protein	157	MUS MUSCULUS	Q07440 (AlphaFold model)
Bcl-2-binding component 3	B, D	protein	26	MUS MUSCULUS	Q99ML1 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2VOF_1 BCL-2-RELATED PROTEIN A1 (chains A, C)
GPLGSMAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSY
LDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLKQEQIALDVSAY
KQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKS

Sequence of entity 2 (B, D), FASTA

>2VOF_2 BCL-2-BINDING COMPONENT 3 (chains B, D)
EEEWAREIGAQLRRIADDLNAQYERR

Primary citation

Structural Plasticity Underpins Promiscuous Binding of the Prosurvival Protein A1. Smits, C., Czabotar, P.E., Hinds, M.G. et al. Structure (2008) 16:818. DOI 10.1016/J.STR.2008.02.009 · PubMed

Other PDB entries of the same protein (UniProt Q07440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VOG 1.9 Å, Structure of mouse A1 bound to the Bmf BH3-domain
2VOH 1.9 Å, Structure of mouse A1 bound to the Bak BH3-domain
2VOI 2.1 Å, Structure of mouse A1 bound to the Bid BH3-domain

Browse structure collections

About this viewer

MolViewer shows 2VOF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.