2VVK: Grb2 SH3C

Grb2 SH3C (1). Determined by X-ray diffraction at 1.6 Å resolution. Released 19 May 2009.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 539
Mol. weight: 6.46 kDa
Released: 19 May 2009

Explore 2VVK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VVK contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	9	1	2
β-strand	16	1	1
β-strand	19	1	2
β-strand	24-29	6	1
β-strand	35-40	6	1
β-strand	43-48	6	1
α-helix	49-51	3
β-strand	52-54	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth factor receptor-bound protein 2	A	protein	56	HOMO SAPIENS	P62993 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VVK_1 GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2 (chains A)
GSVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVN

Primary citation

Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2. Harkiolaki, M., Tsirka, T., Lewitzky, M. et al. Structure (2009) 17:809. DOI 10.1016/J.STR.2009.03.017 · PubMed

Other PDB entries of the same protein (UniProt P62993 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ICG 1.15 Å, Grb2 SH2 domain in phosphopeptide free form
3WA4 1.35 Å, Grb2 SH2 domain/CD28-derived peptide complex
1JYR 1.55 Å, Xray Structure of Grb2 SH2 Domain Complexed with a Phosphorylated Peptide
2VWF 1.58 Å, Grb2 SH3C (2)
3OV1 1.6 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide
4P9V 1.64 Å, Grb2 SH2 complexed with a pTyr-Ac6cN-Asn tripeptide
1GCQ 1.68 Å, Crystal structure of vav and GRB2 SH3 domains
2W0Z 1.7 Å, Grb2 SH3C (3)
3C7I 1.7 Å, X-RAY crystal structure of the complex between the grb2-sh2 domain and a flexible…
3IN8 1.7 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2…
3S8L 1.71 Å, Protein-Ligand Interactions: Thermodynamic Effects Associated with Increasing…
3S8N 1.71 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide

Browse structure collections

About this viewer

MolViewer shows 2VVK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.