2W1S: Hyaluronoglucosaminidase

Unique ligand binding specificity of a family 32 Carbohydrate-Binding Module from the Mu toxin produced by Clostridium perfringens. Determined by X-ray diffraction at 1.45 Å resolution. Released 5 May 2009.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: CLOSTRIDIUM PERFRINGENS
Chains: 2
Atoms: 2,738
Mol. weight: 43.41 kDa
Ligands: CA, BTB
Released: 5 May 2009

Explore 2W1S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W1S contains 6 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	809-812	4	1
β-strand	817-821	5	1
α-helix	823-826	4
β-strand	835-838	4	1
α-helix	840-843	4
β-strand	845	1	2
β-strand	850-868	19	1
β-strand	881-887	7	1
β-strand	894-900	7	1
α-helix	904-905	2
β-strand	909-928	20	1
β-strand	932	1	2
β-strand	936-944	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hyaluronoglucosaminidase	A, B	protein	192	CLOSTRIDIUM PERFRINGENS	P26831 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2W1S_1 HYALURONOGLUCOSAMINIDASE (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASNPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGD
TSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTG
APAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVSDELENAGNKENVYTNTEL
DLLSLAKEDVTK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
BTB	2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol	C8 H19 N O5	1

Water and common crystallization additives (NA) are not listed.

Primary citation

N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh. Ficko-Blean, E., Boraston, A.B. J Mol Biol (2009) 390:208. DOI 10.1016/J.JMB.2009.04.066 · PubMed

Other PDB entries of the same protein (UniProt P26831 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OZN 1.6 Å, The Cohesin-Dockerin Complex of NagJ and NagH from Clostridium perfringens
2W1Q 1.6 Å, Unique ligand binding specificity for a family 32 Carbohydrate- Binding Module from the…
2W1U 2.0 Å, A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium…
2WDB 2.03 Å, A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium…
7RGA 2.9 Å, Crystal structure of nanoCLAMP3:VHH in complex with MTX
2JNK Solution structure of a dockerin-containing modular pair from a family 84 glycoside…

Browse structure collections

About this viewer

MolViewer shows 2W1S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.