2W72: Human hemoglobin a

Deoxygenated structure of a distal site hemoglobin mutant plus xe. Determined by X-ray diffraction at 1.07 Å resolution. Released 28 Apr 2009.

Method: X-ray diffraction
Resolution: 1.07 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 6,291
Mol. weight: 67.75 kDa
Ligands: HEM, XE, PO4
Released: 28 Apr 2009

Explore 2W72 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W72 contains 40 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	18-20	3
α-helix	21-35	15
α-helix	37-42	6
α-helix	53-71	19
α-helix	76-79	4
α-helix	81-86	6
α-helix	87-91	5
α-helix	96-112	17
α-helix	119-137	19

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	5-16	12
α-helix	20-34	15
α-helix	36-41	6
α-helix	51-56	6
α-helix	58-74	17
α-helix	81-94	14
α-helix	101-118	18
α-helix	119-121	3
α-helix	124-142	19

Chain D: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	5-15	11
α-helix	20-34	15
α-helix	36-41	6
α-helix	43-45	3
α-helix	51-56	6
α-helix	58-74	17
α-helix	75-77	3
α-helix	81-94	14
α-helix	101-118	18
α-helix	119-121	3
α-helix	124-142	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human hemoglobin a	A	protein	141	HOMO SAPIENS	P69905 (AlphaFold model)
Human hemoglobin a	B, D	protein	146	HOMO SAPIENS	P68871 (AlphaFold model)
Human hemoglobin a	C	protein	141	HOMO SAPIENS	P69905 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2W72_1 HUMAN HEMOGLOBIN A (chains A)
VLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK
KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
VHASLDKFLASVSTVLTSKYR

Sequence of entity 2 (B, D), FASTA

>2W72_2 HUMAN HEMOGLOBIN A (chains B, D)
MHLTPEEKSAVTALWGKVNVDEVGGEAYGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKV
KAQGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGK
EFTPPVQAAYQKVVAGVANALAHKYH

Sequence of entity 3 (C), FASTA

>2W72_3 HUMAN HEMOGLOBIN A (chains C)
MLSPADKTNVKAAWGKVGAHAGEYGAEAYERMFLSFPTTKTYFPHFDLSHGSAQVKGQGK
KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA
VHASLDKFLASVSTVLTSKYR

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	4
XE	Xenon	Xe	15
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (SO4, K) are not listed.

Primary citation

Pattern of Cavities in Globins: The Case of Human Hemoglobin. Savino, C., Miele, A.E., Draghi, F. et al. Biopolymers (2009) 91:1097. DOI 10.1002/BIP.21201 · PubMed

Other PDB entries of the same protein (UniProt P69905 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IRD 1.25 Å, Crystal Structure of Human Carbonmonoxy-Haemoglobin at 1.25 A Resolution
2DN1 1.25 Å, 1.25A resolution crystal structure of human hemoglobin in the oxy form
2DN2 1.25 Å, 1.25A resolution crystal structure of human hemoglobin in the deoxy form
2DN3 1.25 Å, 1.25A resolution crystal structure of human hemoglobin in the carbonmonoxy form
7DY4 1.3 Å, High resolution crystal structure of hemoglobin M Boston.
6KA9 1.4 Å, Crosslinked alpha(Fe-CO)-beta(Ni) human hemoglobin A in the T quaternary structure at 95…
6KAO 1.4 Å, Carbonmonoxy human hemoglobin C in the R quaternary structure at 95 K: Dark
6LCW 1.4 Å, Crosslinked alpha(Ni)-beta(Ni) human hemoglobin A in the T quaternary structure at 95 K:…
6LCX 1.4 Å, Crosslinked alpha(Ni)-beta(Ni) human hemoglobin A in the T quaternary structure at 95 K:…
7DY3 1.4 Å, High resolution crystal structure of hemoglobin M Iwate.
3S66 1.4 Å, Structures and oxygen affinities of crystalline human hemoglobin C (beta6 Lys) in the R…
1J40 1.45 Å, Direct observation of photolysis-induced tertiary structural changes in human…

Browse structure collections

About this viewer

MolViewer shows 2W72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.