2WCY: Factor I-like modules of complement C7

NMR solution structure of factor I-like modules of complement C7. Determined by solution NMR. Released 19 May 2009.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,167
Mol. weight: 16.98 kDa
Released: 19 May 2009

Explore 2WCY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WCY contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	699-701	3
β-strand	706-709	4	1
β-strand	712-715	4	1
α-helix	718-720	3
β-strand	726-731	6	2
β-strand	737-741	5	2
α-helix	742-750	9
β-strand	755-757	3	2
β-strand	772	1	3
β-strand	775	1	3
β-strand	780-782	3	4
β-strand	788	1	3
β-strand	789-791	3	4
α-helix	794-796	3
β-strand	803-808	6	5
β-strand	811-816	6	5
α-helix	817-826	10
β-strand	831-834	4	5
α-helix	837-838	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement component C7	A	protein	155	HOMO SAPIENS	P10643 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WCY_1 COMPLEMENT COMPONENT C7 (chains A)
GSHMNPLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTVCKMHVL
HCQGRNYTLTGRDSCTLPASAEKACGACPLWGKCDAESSKCVCREASECEEEGFSICVEV
NGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ

Primary citation

Solution Structure of Factor I-Like Modules from Complement C7 Reveals a Pair of Follistatin Domains in Compact Pseudosymmetric Arrangement. Phelan, M.M., Thai, C.T., Soares, D.C. et al. J Biol Chem (2009) 284:19637. DOI 10.1074/JBC.M901993200 · PubMed

Other PDB entries of the same protein (UniProt P10643 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8B0F 3.0 Å, CryoEM structure of C5b8-CD59
7NYD 3.27 Å, cryoEM structure of 2C9-sMAC
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
7NYC 3.54 Å, cryoEM structure of 3C9-sMAC
6H03 5.6 Å, Open conformation of the membrane attack complex
6H04 5.6 Å, Closed conformation of the Membrane Attack Complex

Browse structure collections

About this viewer

MolViewer shows 2WCY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.