7NYC: 3C9-sMAC

cryoEM structure of 3C9-sMAC. Determined by electron microscopy at 3.54 Å resolution. Released 6 Oct 2021.

Method: Electron microscopy
Resolution: 3.54 Å
Organism: Homo sapiens
Chains: 9
Atoms: 41,307
Mol. weight: 710.24 kDa
Ligands: MAN, CA, NAG, FUC
Released: 6 Oct 2021

Explore 7NYC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NYC contains 208 α-helices and 377 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 44 helices, 119 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	82
β-strand	13-14	2	83
β-strand	15	1	84
β-strand	19-26	8	82
β-strand	32-39	8	85
β-strand	47-55	9	85
α-helix	57-59	3
β-strand	62-67	6	82
β-strand	69	1	84
α-helix	71-73	3
β-strand	83-87	5	85
β-strand	88-89	2	86
β-strand	90	1	85
β-strand	94-95	2	86
β-strand	98-100	3	85
β-strand	101-102	2	83
β-strand	107-111	5	87
β-strand	116-117	2	88
β-strand	122	1	89
β-strand	126-130	5	87
β-strand	136	1	87
β-strand	141-146	6	88
β-strand	152-158	7	88
β-strand	164-166	3	87
β-strand	171	1	89
β-strand	179-187	9	88
β-strand	196-201	6	88
β-strand	209-215	7	90
β-strand	219-220	2	90
β-strand	228-236	9	90
β-strand	240-241	2	90
β-strand	244-254	11	90
α-helix	262-263	2
β-strand	264	1	90
β-strand	270-275	6	90
β-strand	278-283	6	90
α-helix	285-292	8
β-strand	303-313	11	90
β-strand	319-329	11	90
β-strand	335-338	4	91
β-strand	344	1	92
α-helix	350	1
β-strand	351-358	8	91
β-strand	364	1	91
β-strand	369-377	9	92
β-strand	383-385	3	92
α-helix	386-388	3
β-strand	389-392	4	92
β-strand	400-404	5	91
β-strand	412-419	8	92
β-strand	431-437	7	92
β-strand	448-450	3	93
α-helix	457	1
β-strand	458	1	94
α-helix	459	1
α-helix	462	1
β-strand	463	1	95
α-helix	464	1
β-strand	466	1	96
β-strand	467-469	3	93
α-helix	475-477	3
β-strand	480-487	8	97
β-strand	490-498	9	97
β-strand	499	1	98
β-strand	505	1	98
β-strand	508	1	96
β-strand	511	1	95
α-helix	514-516	3
β-strand	520-529	10	97
β-strand	534-543	10	97
β-strand	545	1	94
β-strand	554-557	4	99
β-strand	564	1	100
β-strand	569-575	7	99
β-strand	580-588	9	101
α-helix	590-594	5
α-helix	598-600	3
α-helix	605-611	7
β-strand	619	1	97
α-helix	624-630	7
β-strand	633-637	5	82
α-helix	643-645	3
β-strand	754-762	9	101
β-strand	767-771	5	99
α-helix	772-773	2
β-strand	778-787	10	101
β-strand	790-793	4	101
α-helix	794-796	3
β-strand	797-800	4	101
β-strand	801	1	100
β-strand	805-810	6	102
β-strand	814-816	3	103
β-strand	821-829	9	102
β-strand	835-836	2	104
β-strand	840-843	4	103
β-strand	847-849	3	102
β-strand	869-870	2	104
β-strand	874-884	11	102
β-strand	888-895	8	103
β-strand	904-912	9	103
β-strand	916-925	10	105
β-strand	927	1	106
β-strand	936	1	106
β-strand	938-941	4	107
β-strand	949	1	105
β-strand	956-962	7	105
β-strand	974	1	64
α-helix	978-982	5
α-helix	992-997	6
α-helix	1000-1010	11
α-helix	1013-1016	4
α-helix	1020-1039	20
β-strand	1042	1	108
β-strand	1048	1	108
α-helix	1055-1056	2
β-strand	1057	1	108
α-helix	1058-1071	14
α-helix	1079-1092	14
α-helix	1123-1138	16
α-helix	1144-1160	17
α-helix	1167-1178	12
α-helix	1185-1196	12
β-strand	1199-1201	3	109
β-strand	1207-1209	3	109
α-helix	1224-1240	17
α-helix	1246-1255	10
α-helix	1269-1289	21
β-strand	1292	1	110
β-strand	1293-1299	7	107
β-strand	1304-1310	7	107
β-strand	1316-1322	7	105
β-strand	1328-1332	5	107
β-strand	1336	1	110
β-strand	1340-1349	10	105
β-strand	1359-1366	8	111
β-strand	1382-1390	9	111
β-strand	1404-1408	5	112
β-strand	1414-1416	3	111
α-helix	1418-1421	4
α-helix	1423-1426	4
β-strand	1432-1438	7	112
β-strand	1441-1446	6	112
β-strand	1455-1463	9	111
α-helix	1471-1472	2
β-strand	1473-1479	7	112
β-strand	1482-1491	10	112
α-helix	1495-1496	2
β-strand	1498-1499	2	113
β-strand	1510-1511	2	113
α-helix	1517-1519	3
α-helix	1527-1534	8
β-strand	1541-1549	9	114
β-strand	1557	1	115
β-strand	1560-1566	7	114
β-strand	1582	1	116
β-strand	1584	1	115
α-helix	1589-1591	3
β-strand	1598-1603	6	114
α-helix	1604-1607	4
β-strand	1619	1	116
β-strand	1626-1629	4	114
α-helix	1635-1637	3
α-helix	1640-1655	16

Chain B: 35 helices, 52 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	9-14	6
β-strand	22-26	5	52
α-helix	33-37	5
α-helix	40-43	4
β-strand	47-51	5	52
α-helix	56-57	2
β-strand	59	1	53
α-helix	60-61	2
β-strand	62-63	2	54
α-helix	68	1
β-strand	69	1	55
α-helix	70	1
α-helix	72	1
β-strand	73	1	55
β-strand	78-82	5	55
β-strand	85-87	3	54
β-strand	89	1	56
β-strand	90	1	53
β-strand	101-105	5	55
α-helix	114-117	4
α-helix	119-121	3
β-strand	123-124	2	57
β-strand	130-131	2	57
α-helix	133-135	3
α-helix	155	1
β-strand	164-165	2	58
α-helix	166	1
α-helix	169-173	5
β-strand	175-177	3	59
β-strand	182-184	3	59
β-strand	188	1	60
β-strand	199-201	3	58
α-helix	207	1
β-strand	208-210	3	58
α-helix	211-212	2
β-strand	215-220	6	59
β-strand	224-251	28	6
β-strand	269-299	31	6
β-strand	302-306	5	59
β-strand	313	1	60
α-helix	315-323	9
α-helix	330-340	11
β-strand	343-351	9	59
β-strand	352-382	31	6
β-strand	394-424	31	6
α-helix	428-436	9
α-helix	445-457	13
β-strand	460-468	9	59
α-helix	469-471	3
α-helix	479-497	19
α-helix	499-501	3
α-helix	503-505	3
α-helix	506-508	3
α-helix	509	1
β-strand	510-513	4	61
β-strand	517	1	56
β-strand	518-521	4	61
α-helix	522-523	2
β-strand	526-527	2	62
β-strand	533-534	2	62
α-helix	538-540	3
α-helix	549-553	5
β-strand	554	1	63
α-helix	555-556	2
β-strand	563-565	3	63
α-helix	579-580	2
β-strand	585-587	3	63
β-strand	595	1	64
α-helix	614-616	3
β-strand	623-624	2	65
α-helix	625-626	2
β-strand	632-634	3	66
β-strand	640-641	2	65
α-helix	642	1
β-strand	646-648	3	67
β-strand	649-651	3	66
β-strand	655-659	5	68
β-strand	662-664	3	67
β-strand	676-680	5	68
β-strand	682-683	2	69
β-strand	694-695	2	70
β-strand	701-702	2	69
β-strand	706-709	4	70
β-strand	722-724	3	70
β-strand	726	1	71
β-strand	728	1	71

Chain C: 41 helices, 60 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4	1	1
α-helix	5-6	2
β-strand	7-8	2	2
α-helix	9-12	4
α-helix	17	1
β-strand	18	1	3
β-strand	23-27	5	3
β-strand	30-32	3	2
β-strand	34	1	4
β-strand	35	1	1
α-helix	38-42	5
β-strand	46-50	5	3
α-helix	56-59	4
β-strand	67-68	2	5
β-strand	74-75	2	5
α-helix	77-79	3
α-helix	92-94	3
α-helix	110-111	2
α-helix	115-118	4
β-strand	120-122	3	6
β-strand	129-132	4	6
β-strand	134	1	7
β-strand	145-148	4	8
β-strand	153-156	4	8
β-strand	161-164	4	6
β-strand	169-199	31	6
β-strand	205-242	38	6
α-helix	243-244	2
β-strand	250	1	7
α-helix	252-260	9
α-helix	267-277	11
β-strand	278	1	6
β-strand	280-317	38	6
β-strand	330-351	22	6
β-strand	354-356	3	6
α-helix	360-366	7
α-helix	378-387	10
α-helix	388-390	3
β-strand	393-401	9	6
α-helix	402-405	4
α-helix	412-430	19
α-helix	432-434	3
α-helix	436-438	3
α-helix	442	1
β-strand	443-447	5	4
β-strand	450-454	5	4
α-helix	455-456	2
β-strand	459-460	2	9
β-strand	466-467	2	9
β-strand	477	1	10
α-helix	481-484	4
β-strand	485-491	7	11
β-strand	494-498	5	11
α-helix	505	1
β-strand	507	1	10
α-helix	510-513	4
β-strand	518-522	5	11
α-helix	525-526	2
α-helix	527-531	5
α-helix	532-534	3
α-helix	536-538	3
β-strand	548-549	2	12
α-helix	550-553	4
β-strand	555	1	13
β-strand	558-560	3	13
β-strand	567-568	2	12
β-strand	573-574	2	14
β-strand	575-577	3	13
β-strand	581-585	5	15
β-strand	588-589	2	14
α-helix	593-595	3
β-strand	602-606	5	15
β-strand	619-620	2	16
α-helix	627-628	2
β-strand	633-634	2	17
β-strand	635-636	2	16
α-helix	637	1
β-strand	648-649	2	17
β-strand	684	1	18
β-strand	687	1	19
β-strand	690	1	19
β-strand	693	1	18
α-helix	694-695	2
α-helix	703	1
β-strand	704-708	5	20
β-strand	715-719	5	20
α-helix	720-728	9
β-strand	734-735	2	20
β-strand	750	1	21
β-strand	758-760	3	22
α-helix	761	1
β-strand	766	1	21
β-strand	767-769	3	22
α-helix	770-771	2
α-helix	772-774	3
β-strand	781-786	6	23
β-strand	789-794	6	23
α-helix	795-803	9
β-strand	808-812	5	23
α-helix	815-816	2

Chain D: 18 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	24
β-strand	12-13	2	25
α-helix	14	1
α-helix	16-23	8
β-strand	28-32	5	26
β-strand	35-37	3	25
β-strand	39	1	27
β-strand	40	1	24
α-helix	43-45	3
α-helix	48-50	3
β-strand	51-55	5	26
β-strand	72	1	28
β-strand	79	1	28
α-helix	82-84	3
α-helix	96-98	3
β-strand	113-114	2	29
α-helix	115	1
α-helix	118-121	4
β-strand	123-126	4	6
β-strand	131-135	5	6
β-strand	137	1	30
β-strand	149-151	3	29
β-strand	154-157	4	29
β-strand	162-166	5	6
β-strand	170-196	27	6
β-strand	220-252	33	6
β-strand	259	1	30
α-helix	261-268	8
α-helix	276-286	11
β-strand	289-322	34	6
β-strand	351-373	23	6
β-strand	375	1	31
α-helix	378-385	8
α-helix	389-391	3
α-helix	392-402	11
β-strand	406	1	31
β-strand	407-415	9	6
α-helix	416-418	3
α-helix	428-446	19
α-helix	448-450	3
α-helix	452-454	3
β-strand	459-460	2	32
β-strand	466	1	27
β-strand	469-470	2	32
β-strand	476	1	33
β-strand	482	1	33
α-helix	494-498	5
β-strand	506-509	4	34
β-strand	531-534	4	34

Chain E: 19 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	10	1	35
α-helix	11-19	9
β-strand	21	1	36
β-strand	26-30	5	36
β-strand	35	1	35
β-strand	37	1	37
α-helix	42-44	3
β-strand	49-53	5	36
α-helix	59-62	4
α-helix	63-66	4
β-strand	71	1	38
β-strand	78	1	38
α-helix	81-83	3
α-helix	95-97	3
α-helix	110-112	3
β-strand	115	1	39
β-strand	124-126	3	6
β-strand	133-136	4	6
β-strand	138	1	40
β-strand	149-151	3	39
β-strand	158-161	4	41
β-strand	166-169	4	41
β-strand	175-177	3	39
α-helix	178-179	2
β-strand	182-185	4	6
β-strand	190-212	23	6
β-strand	246-273	28	6
β-strand	278	1	42
β-strand	280	1	40
α-helix	282-289	8
α-helix	297-307	11
β-strand	310-338	29	6
β-strand	376-394	19	6
α-helix	398-406	9
α-helix	410-420	11
β-strand	425-433	9	6
α-helix	436-439	4
β-strand	441	1	42
α-helix	447-463	17
α-helix	466-469	4
α-helix	476	1
β-strand	477-481	5	37
β-strand	484-488	5	37
β-strand	508	1	43
α-helix	512-520	9
β-strand	522	1	44
β-strand	525	1	44
β-strand	527-529	3	45
α-helix	536-537	2
β-strand	538	1	43
β-strand	549-551	3	45

Chain F: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
β-strand	29-37	9	117
α-helix	41-45	5
β-strand	53-59	7	117
β-strand	64-72	9	117
β-strand	75-83	9	117
β-strand	85	1	117
β-strand	91-92	2	117
α-helix	94-96	3
β-strand	104-111	8	117
β-strand	115-122	8	117
β-strand	125-132	8	117
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	117
α-helix	173-175	3
β-strand	176	1	117

Chain G: 18 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	46
α-helix	27-34	8
β-strand	39-43	5	47
β-strand	46-51	6	46
β-strand	62-66	5	47
α-helix	72-75	4
β-strand	84-85	2	48
β-strand	91-92	2	48
α-helix	94-98	5
α-helix	109-111	3
β-strand	127	1	49
α-helix	130-133	4
β-strand	138-139	2	6
β-strand	147	1	6
α-helix	149	1
β-strand	151	1	50
β-strand	162-163	2	49
β-strand	172-173	2	49
α-helix	174-175	2
β-strand	178-182	5	6
β-strand	186-199	14	6
β-strand	268-287	20	6
α-helix	292-293	2
β-strand	294	1	50
α-helix	295	1
α-helix	296-303	8
α-helix	311-321	11
β-strand	324-345	22	6
β-strand	398-409	12	6
α-helix	413-422	10
α-helix	431-440	10
α-helix	441-443	3
β-strand	446-454	9	6
α-helix	455-458	4
α-helix	466-483	18
α-helix	486-488	3
α-helix	490-492	3
β-strand	498-501	4	46
β-strand	504-507	4	46
β-strand	514	1	51
β-strand	520	1	51

Chain H: 15 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	72
β-strand	23-25	3	73
α-helix	31-33	3
β-strand	34	1	74
β-strand	39-43	5	74
β-strand	45-48	4	73
β-strand	51	1	72
α-helix	54-56	3
β-strand	62-66	5	74
α-helix	72-75	4
β-strand	84-85	2	75
β-strand	91-92	2	75
α-helix	94-97	4
α-helix	107-112	6
β-strand	127-128	2	76
α-helix	130-133	4
β-strand	138-140	3	77
β-strand	145-147	3	77
β-strand	151	1	78
β-strand	162-163	2	76
β-strand	172-173	2	76
β-strand	178-182	5	79
β-strand	187-203	17	6
β-strand	264-283	20	6
β-strand	284-287	4	79
β-strand	294	1	78
α-helix	296-301	6
α-helix	311-321	11
β-strand	324-326	3	77
β-strand	330-348	19	6
β-strand	395-409	15	6
α-helix	413-422	10
α-helix	427-430	4
α-helix	431-440	10
β-strand	446-449	4	6
β-strand	452-454	3	77
α-helix	455-458	4
α-helix	466-483	18
α-helix	486-488	3
α-helix	490-493	4
β-strand	499-501	3	72
β-strand	504-506	3	72
β-strand	507	1	80
β-strand	514	1	81
β-strand	517	1	80
β-strand	520	1	81

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement component C7	C	protein	821	Homo sapiens	P10643 (AlphaFold model)
Complement component C8 beta chain	D	protein	537	Homo sapiens	P07358 (AlphaFold model)
Complement component C8 alpha chain	E	protein	554	Homo sapiens	P07357 (AlphaFold model)
Complement component C9	G, H, I	protein	538	Homo sapiens	P02748 (AlphaFold model)
Complement component C6	B	protein	913	Homo sapiens	P13671
Complement C5	A	protein	1658	Homo sapiens	P01031
Complement component C8 gamma chain	F	protein	182	Homo sapiens	P07360

Sequence of entity 1 (C), FASTA

>7NYC_1 Complement component C7 (chains C)
SSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFETQSCEPTRGCPTE
EGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELTGN
GYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYN
STWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQF
INNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSE
KLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGA
GFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLK
WALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGG
WSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFP
LSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVG
EMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPE
MKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTV
CKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWGKCDAESSKCVCREASECEEEGF
SICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ

Sequence of entity 2 (D), FASTA

>7NYC_2 Complement component C8 beta chain (chains D)
SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNR
PCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGS
LASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEY
ESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLH
ARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIY
EYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRN
KRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELV
TATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLAC
EVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Sequence of entity 3 (E), FASTA

>7NYC_3 Complement component C8 alpha chain (chains E)
AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTC
VRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQ
KAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPY
NFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHS
QDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMY
AKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINV
GGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSL
KYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPIL
EGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNG
GASCPGRKVQTQAC

Sequence of entity 4 (G, H, I), FASTA

>7NYC_4 Complement component C9 (chains G, H, I)
QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDA
VGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPP
CRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVAS
LIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASS
ISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD
DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCL
GYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELK
EKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDY
INEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK

Sequence of entity 5 (B), FASTA

>7NYC_5 Complement component C6 (chains B)
CFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQETRECNWQRCPIN
CLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCK
NKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLA
GEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDLKTDFYKDLTSL
GHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHKVMK
VLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQF
SSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSI
SLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCAV
TKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKS
NAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQ
PCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGY
QYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGP
SRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLC
VFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKES
CGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCAN
RKMEILHPGKCLA

Sequence of entity 6 (A), FASTA

>7NYC_6 Complement C5 (chains A)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILRPRRT
LQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQL
RANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWE
IQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVK
MSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETWF
GKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILS
VKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDP
LIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQN
SICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDI
CPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALV
KGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQ
RYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPV
EVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSD
YKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDG
HVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQK
VCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYK
ATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYP
LDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 7 (F), FASTA

>7NYC_7 Complement component C8 gamma chain (chains F)
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQ
GTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYL
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
RR

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	7
CA	Calcium ion	Ca	3
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4
FUC	alpha-L-fucopyranose	C6 H12 O5	1

Primary citation

Structural basis of soluble membrane attack complex packaging for clearance. Menny, A., Lukassen, M.V., Couves, E.C. et al. Nat Commun (2021) 12:6086-6086. DOI 10.1038/s41467-021-26366-w · PubMed

Other PDB entries of the same protein (UniProt P10643 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8B0F 3.0 Å, CryoEM structure of C5b8-CD59
7NYD 3.27 Å, cryoEM structure of 2C9-sMAC
8B0G 3.3 Å, 2C9, C5b9-CD59 structure
8B0H 3.3 Å, 2C9, C5b9-CD59 cryoEM structure
6H03 5.6 Å, Open conformation of the membrane attack complex
6H04 5.6 Å, Closed conformation of the Membrane Attack Complex
2WCY NMR solution structure of factor I-like modules of complement C7.

Browse structure collections

About this viewer

MolViewer shows 7NYC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.