Structure of a photoactivatable Rac1 containing Lov2 Wildtype. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Aug 2009.
Explore 2WKP in 3D Show helices and sheets RCSB PDB PDBe
2WKP contains 18 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 405-407 | 3 | |
| α-helix | 408-410 | 3 | |
| β-strand | 415-418 | 4 | 1 |
| β-strand | 427-430 | 4 | 1 |
| α-helix | 432-438 | 7 | |
| α-helix | 442-445 | 4 | |
| α-helix | 450-453 | 4 | |
| α-helix | 460-471 | 12 | |
| β-strand | 476-483 | 8 | 1 |
| β-strand | 489-500 | 12 | 1 |
| β-strand | 506-516 | 11 | 1 |
| α-helix | 522-543 | 22 | |
| β-strand | 547-553 | 7 | 2 |
| α-helix | 559-568 | 10 | |
| β-strand | 580-589 | 10 | 2 |
| β-strand | 592-601 | 10 | 2 |
| α-helix | 605-607 | 3 | |
| α-helix | 611-614 | 4 | |
| β-strand | 620-626 | 7 | 2 |
| α-helix | 630-635 | 6 | |
| α-helix | 636-640 | 5 | |
| α-helix | 641-647 | 7 | |
| β-strand | 653-658 | 6 | 2 |
| α-helix | 660-662 | 3 | |
| α-helix | 666-674 | 9 | |
| α-helix | 679-681 | 3 | |
| α-helix | 682-692 | 11 | |
| β-strand | 696-699 | 4 | 2 |
| α-helix | 708-720 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NPH1-1, ras-related C3 botulinum toxin substrate 1 | A | protein | 332 | AVENA SATIVA, HOMO SAPIENS | O49003 (AlphaFold model), P63000 (AlphaFold model) |
>2WKP_1 NPH1-1, RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1 (chains A) MRGSHHHHHHGSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCR FLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIG VQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTTNAF PGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPA SFHHVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKE IGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
| ID | Name | Formula | Copies |
|---|---|---|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 1 |
| FMN | Flavin mononucleotide | C17 H21 N4 O9 P | 1 |
| MG | Magnesium ion | Mg | 1 |
| CA | Calcium ion | Ca | 1 |
A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells. Wu, Y.I., Frey, D., Lungu, O.I. et al. Nature (2009) 461:104. DOI 10.1038/NATURE08241 · PubMed
Other PDB entries of the same protein (UniProt O49003 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2WKP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.