2WNT: Human Ribosomal protein S6 kinase

Crystal Structure of the Human Ribosomal protein S6 kinase. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Aug 2009.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 4,629
Mol. weight: 74.63 kDa
Released: 25 Aug 2009

Explore 2WNT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WNT contains 34 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	418-427	10	1
β-strand	430-437	8	1
β-strand	443-450	8	1
α-helix	457-466	10
β-strand	472	1	2
α-helix	473-474	2
β-strand	475-480	6	1
β-strand	484-489	6	1
β-strand	496	1	2
α-helix	497-502	6
α-helix	509-528	20
β-strand	531-532	2	3
α-helix	538-540	3
β-strand	541-543	3	2
α-helix	550-552	3
β-strand	553-555	3	2
β-strand	562-563	2	3
β-strand	565	1	4
β-strand	571	1	4
α-helix	588-609	22
α-helix	622-631	10
α-helix	639-643	5
α-helix	646-655	10
α-helix	660-662	3
α-helix	664-665	2
α-helix	666-670	5
α-helix	673-676	4
α-helix	678-680	3
α-helix	685-687	3
α-helix	691-707	17

Chain B: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	418-426	9	5
β-strand	430-437	8	5
β-strand	443-450	8	5
α-helix	457-466	10
β-strand	472	1	6
α-helix	473-474	2
β-strand	475-480	6	5
β-strand	484-490	7	5
β-strand	496	1	6
α-helix	497-501	5
α-helix	509-528	20
β-strand	531-532	2	7
α-helix	538-540	3
β-strand	541-543	3	6
α-helix	550-552	3
β-strand	553-555	3	6
β-strand	562-563	2	7
β-strand	565	1	8
β-strand	571	1	8
α-helix	588-609	22
α-helix	622-631	10
α-helix	639-642	4
α-helix	646-655	10
α-helix	660-662	3
α-helix	664-665	2
α-helix	666-670	5
α-helix	673-676	4
α-helix	678-680	3
α-helix	685-687	3
α-helix	691-707	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein S6 kinase	A, B	protein	330	HOMO SAPIENS	Q15418 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2WNT_1 RIBOSOMAL PROTEIN S6 KINASE (chains A, B)
MHHHHHHSSGVDLGTENLYFQSMVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVI
DKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSE
REASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRI
GSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQ
DLQLVKGAMAATYSALNSSKPTPQLKPIES

Primary citation

Crystal Structure of the Human Ribosomal Protein S6 Kinase. Muniz, J.R.C., Elkins, J.M., Wang, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q15418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V62 1.9 Å, Phospho-ERK2 bound to bivalent inhibitor SBP3
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
2Z7Q 2.0 Å, Crystal structure of the N-terminal kinase domain of human RSK-1 bound to AMP-PCP
2Z7R 2.0 Å, Crystal Structure of the N-terminal Kinase Domain of Human RSK1 bound to Staurosporine
2Z7S 2.1 Å, Crystal Structure of the N-terminal Kinase Domain of Human RSK1 bound to Purvalnol A
5CSI 2.13 Å, S100B-RSK1 crystal structure A'
4NIF 2.15 Å, Heterodimeric structure of ERK2 and RSK1
5V61 2.2 Å, Phospho-ERK2 bound to bivalent inhibitor SBP2
4H3P 2.3 Å, Crystal structure of human ERK2 complexed with a MAPK docking peptide
5N7D 2.3 Å, MAGI-1 complexed with a RSK1 peptide
5N7F 2.3 Å, MAGI-1 complexed with a pRSK1 peptide
6TWY 2.3 Å, MAGI1_2 complexed with a phosphomimetic RSK1 peptide

Browse structure collections

About this viewer

MolViewer shows 2WNT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.