2WPR: Trimeric autotransporter adhesin fragment

Salmonella enterica SadA 483-523 fused to GCN4 adaptors (SadAK3b-V1, out-of-register fusion). Determined by X-ray diffraction at 2.65 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM
Chains: 3
Atoms: 2,300
Mol. weight: 37.8 kDa
Released: 3 Nov 2009

Explore 2WPR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WPR contains 5 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	458-552	95

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	458-479	22
α-helix	481-552	72

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	458-478	21
α-helix	481-552	72

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trimeric autotransporter adhesin fragment	A, B, C	protein	107	SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM	Q8ZL64 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2WPR_1 TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT (chains A, B, C)
MKQIEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNI
NNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKLIKLHHHHHH

Primary citation

A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core. Hartmann, M.D., Ridderbusch, O., Zeth, K. et al. Proc Natl Acad Sci U S A (2009) 106:16950. DOI 10.1073/PNAS.0907256106 · PubMed

Other PDB entries of the same protein (UniProt Q8ZL64 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
2YNZ 1.4 Å, Salmonella enterica SadA 823-947 fused to a GCN4 adaptor (SadAK5)
2WPQ 1.85 Å, Salmonella enterica SadA 479-519 fused to GCN4 adaptors (SadAK3, in- register fusion)
3ZMF 1.85 Å, Salmonella enterica SadA 303-358 fused to GCN4 adaptors (SadAK2)
2YO2 2.0 Å, Salmonella enterica SadA 255-358 fused to GCN4 adaptors (SadAK12)
2YO3 2.0 Å, Salmonella enterica SadA 1185-1386 fused to GCN4 adaptors (SadAK14)
2WPS 2.6 Å, Salmonella enterica SadA 483-523 fused to GCN4 adaptors (SadAK3b-V2, out-of-register…
2YO0 2.8 Å, Salmonella enterica SadA 1049-1304 fused to GCN4 adaptors (SadAK9-cfI)
2YO1 3.1 Å, Salmonella enterica SadA 1049-1304 fused to GCN4 adaptors (SadAK9- cfII)

Browse structure collections

About this viewer

MolViewer shows 2WPR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.