Salmonella enterica SadA 483-523 fused to GCN4 adaptors (SadAK3b-V2, out-of-register fusion). Determined by X-ray diffraction at 2.6 Å resolution. Released 3 Nov 2009.
Explore 2WPS in 3D Show helices and sheets RCSB PDB PDBe
2WPS contains 6 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 457-479 | 23 | |
| α-helix | 481-552 | 72 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 457-478 | 22 | |
| α-helix | 480-552 | 73 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Trimeric autotransporter adhesin fragment | A, B, C | protein | 107 | SALMONELLA ENTERICA SUBSP. ENTERICA SEROVAR TYPHIMURIUM | Q8ZL64 (AlphaFold model) |
>2WPS_1 TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT (chains A, B, C) MKQIEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNI NNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKLIKLHHHHHH
A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core. Hartmann, M.D., Ridderbusch, O., Zeth, K. et al. Proc Natl Acad Sci U S A (2009) 106:16950. DOI 10.1073/PNAS.0907256106 · PubMed
Other PDB entries of the same protein (UniProt Q8ZL64 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2WPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.