2WR6: Complex of RBP4 with linoleic acid

Structure of the complex of RBP4 with linoleic acid. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Sept 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,693
Mol. weight: 20.43 kDa
Ligands: ODT
Released: 15 Sept 2010

Explore 2WR6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WR6 contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
α-helix	6-8	3
α-helix	17-20	4
β-strand	22-30	9	2
β-strand	37-47	11	2
β-strand	53-62	10	2
β-strand	68-79	12	2
β-strand	85-92	8	2
β-strand	100-109	10	2
β-strand	114-118	5	2
β-strand	119-123	5	3
β-strand	128	1	1
β-strand	129-133	5	3
β-strand	134-138	5	2
α-helix	146-158	13
β-strand	166-167	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinol-binding protein 4	A	protein	175	HOMO SAPIENS	P02753 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WR6_1 RETINOL-BINDING PROTEIN 4 (chains A)
GERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKG
RVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYS
CRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC

Ligands and cofactors

ID	Name	Formula	Copies
ODT	(11E,13E,15Z)-octadeca-11,13,15-trienoic acid	C18 H30 O2	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Identification of a Non-Retinoid Compound and Fatty Acids as Ligands for Retinol Binding Protein 4 and Their Implications in Diabetes. Huang, H.-J., Nanao, M., Stout, T. et al. To be published.

Other PDB entries of the same protein (UniProt P02753 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NU2 1.5 Å, Structure of non-fluorescent human urine RBP4
5NU7 1.5 Å, Structure of human holo plasma RBP4
5NU9 1.5 Å, Structure of human amniotic fluid RBP4 saturated with palmitate
5NU8 1.59 Å, Structure of human urine RBP4 saturated with palmitate
5NUA 1.6 Å, Structure of human urine RBP4 saturated with laurate
5NUB 1.6 Å, Structure of human amniotic fluid RBP4 saturated with laurate
2WQ9 1.65 Å, Crystal Structure of RBP4 bound to Oleic Acid
5NU6 1.68 Å, Structure of non-fluorescent human amniotic fluid RBP4
1JYD 1.7 Å, Crystal Structure of Recombinant Human Serum Retinol-Binding Protein at 1.7 A Resolution
6QBA 1.8 Å, Crystal Structure of Retinol-Binding Protein 4 (RBP4) in complex with non-retinoid…
1JYJ 2.0 Å, Crystal Structure of a Double Variant (W67L/W91H) of Recombinant Human Serum…
1RBP 2.0 Å, Crystallographic refinement of human serum retinol binding protein at 2 Å resolution

Browse structure collections

About this viewer

MolViewer shows 2WR6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.