2WVI: N-terminal Domain of BubR1

Crystal Structure of the N-terminal Domain of BubR1. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 Mar 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,489
Mol. weight: 20.06 kDa
Ligands: PR
Released: 9 Mar 2010

Explore 2WVI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WVI contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	60-65	6
α-helix	75-88	14
α-helix	98-108	11
α-helix	113-115	3
α-helix	119-131	13
α-helix	135-144	10
β-strand	151	1	1
α-helix	152-164	13
α-helix	168-180	13
β-strand	184	1	1
α-helix	186-218	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta	A	protein	164	HOMO SAPIENS	O60566 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WVI_1 MITOTIC CHECKPOINT SERINE/THREONINE-PROTEIN KINASE BUB1 BETA (chains A)
QQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYY
SDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQ
EGIQQKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESS

Ligands and cofactors

ID	Name	Formula	Copies
PR	Praseodymium ion	Pr	2

Water and common crystallization additives (ACT, EDO) are not listed.

Primary citation

Defining the Molecular Basis of Bubr1 Kinetochore Interactions and Anaphase-Promoting Complex/Cyclosome (Apc/C)-Cdc20 Inhibition. D'Arcy, S., Davies, O.R., Blundell, T.L. et al. J Biol Chem (2010) 285:14764. DOI 10.1074/JBC.M109.082016 · PubMed

Other PDB entries of the same protein (UniProt O60566 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SI5 2.2 Å, Kinetochore-BUBR1 kinase complex
5JJA 2.35 Å, Crystal structure of a PP2A B56gamma/BubR1 complex
4GGD 2.44 Å, Structural analysis of human Cdc20 supports multisite degron recognition by APC/C.
5K6S 2.79 Å, The structure of the PP2A B56 subunit BubR1 complex
5SWF 2.82 Å, The structure of the PP2A B56 subunit double phosphorylated BubR1 complex
6TLJ 3.8 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
5LCW 4.2 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
5KHU 4.8 Å, Model of human Anaphase-promoting complex/Cyclosome (APC15 deletion mutant), in complex…

Browse structure collections

About this viewer

MolViewer shows 2WVI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.