5JJA: PP2A B56gamma/BubR1 complex

Crystal structure of a PP2A B56gamma/BubR1 complex. Determined by X-ray diffraction at 2.35 Å resolution. Released 13 Jul 2016.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,927
Mol. weight: 98.73 kDa
Released: 13 Jul 2016

Explore 5JJA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JJA contains 60 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	30-32	3
α-helix	38-48	11
α-helix	63-82	20
α-helix	91-103	13
α-helix	106-108	3
α-helix	125-127	3
α-helix	131-146	16
α-helix	152-155	4
α-helix	161-169	9
α-helix	170-172	3
α-helix	176-192	17
α-helix	194-196	3
α-helix	197-210	14
α-helix	211-215	5
α-helix	221-233	13
α-helix	239-240	2
α-helix	241-246	6
α-helix	247-251	5
α-helix	253-256	4
α-helix	260-262	3
α-helix	264-277	14
α-helix	279-281	3
α-helix	282-292	11
α-helix	301-313	13
α-helix	317-335	19
α-helix	340-347	8
α-helix	348-351	4
α-helix	353-360	8
α-helix	363-370	8

Chain B: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	35-37	3
α-helix	38-48	11
α-helix	51-54	4
α-helix	63-82	20
α-helix	91-103	13
α-helix	106-108	3
α-helix	125-127	3
α-helix	131-146	16
α-helix	152-155	4
α-helix	161-169	9
α-helix	170-172	3
α-helix	176-192	17
α-helix	194-196	3
α-helix	197-210	14
α-helix	211-215	5
α-helix	221-233	13
α-helix	239-240	2
α-helix	241-246	6
α-helix	247-251	5
α-helix	253-256	4
α-helix	260-277	18
α-helix	279-281	3
α-helix	282-292	11
α-helix	301-313	13
α-helix	317-335	19
α-helix	340-347	8
α-helix	348-351	4
α-helix	353-360	8
α-helix	363-370	8

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	669-671	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	A, B	protein	352	Homo sapiens	Q13362 (AlphaFold model)
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta	C, D	protein	75	Homo sapiens	O60566 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5JJA_1 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (chains A, B)
GIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVIT
EPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESP
DFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIF
YRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLA
YCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLF
RQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKT

Sequence of entity 2 (C, D), FASTA

>5JJA_2 Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (chains C, D)
GKTSEDQQTACGTIYSQTLSIKKLDPIIEDDREADHSSGFSGSSASVASTSSIKCLQIPE
KLELTNETSENPTQS

Primary citation

Crystal structure of a PP2A B56-BubR1 complex and its implications for PP2A substrate recruitment and localization. Wang, J., Wang, Z., Yu, T. et al. Protein Cell (2016) 7:516-526. DOI 10.1007/s13238-016-0283-4 · PubMed

Other PDB entries of the same protein (UniProt Q13362 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VRO 2.45 Å, The structure of the PP2A B56 subunit AIM1 complex
2JAK 2.6 Å, Human PP2A regulatory subunit B56g
3FGA 2.7 Å, Structural Basis of PP2A and Sgo interaction
5K6S 2.79 Å, The structure of the PP2A B56 subunit BubR1 complex
5SWF 2.82 Å, The structure of the PP2A B56 subunit double phosphorylated BubR1 complex
5SW9 2.85 Å, The structure of the PP2A B56 subunit RepoMan complex
9GNJ 2.85 Å, Crystal structure of a PP2A B56gamma double phosphorylated BRCA2 complex
7OUF 3.0 Å, Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor XZ450
7OUG 3.1 Å, STLV-1 intasome:B56 in complex with the strand-transfer inhibitor raltegravir
6OYL 3.15 Å, The structure of the PP2A B56 subunit KIF4A complex
6TOQ 3.16 Å, Crystal structure of a PP2A B56y/HTLV-1 integrase complex
9MF5 3.2 Å, CryoEM structure of the Protein Phosphatase 2A (Abeta-B56gamma-Calpha) holoenzyme complex

Browse structure collections

About this viewer

MolViewer shows 5JJA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.