Yersinia Pestis Plasminogen Activator Pla (Native). Determined by X-ray diffraction at 1.85 Å resolution. Released 28 Jul 2010.
Explore 2X55 in 3D Show helices and sheets RCSB PDB PDBe
2X55 contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-32 | 19 | 1 |
| β-strand | 39-62 | 24 | 1 |
| β-strand | 65-74 | 10 | 1 |
| β-strand | 78-86 | 9 | 1 |
| β-strand | 97-122 | 26 | 1 |
| β-strand | 126-144 | 19 | 1 |
| β-strand | 147-150 | 4 | 1 |
| β-strand | 155-158 | 4 | 1 |
| α-helix | 159-160 | 2 | |
| β-strand | 164-185 | 22 | 1 |
| β-strand | 188-208 | 21 | 1 |
| α-helix | 209-211 | 3 | |
| β-strand | 213-236 | 24 | 1 |
| β-strand | 239-250 | 12 | 1 |
| β-strand | 270 | 1 | 1 |
| α-helix | 272-274 | 3 | |
| β-strand | 275-292 | 18 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulase/fibrinolysin | A | protein | 293 | YERSINIA PESTIS | P17811 (AlphaFold model) |
>2X55_1 COAGULASE/FIBRINOLYSIN (chains A) ASSQLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKISQLDWKIKNVAILKGDISWD PYSFLTLNARGWTSLASGSGNMDDYDWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWL LQDENYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLA GQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAK VFAEFTYSKYDEGKGGTQTIDKNSGDSVSIGGDAAGISNKNYTVTAGLQYRFG
| ID | Name | Formula | Copies |
|---|---|---|---|
| C8E | (hydroxyethyloxy)tri(ethyloxy)octane | C16 H34 O5 | 23 |
Water and common crystallization additives (SO4) are not listed.
An Active Site Water Network in the Plasminogen Activator Pla from Yersinia Pestis. Eren, E., Murphy, M., Goguen, J. et al. Structure (2010) 18:809. DOI 10.1016/J.STR.2010.03.013 · PubMed
Other PDB entries of the same protein (UniProt P17811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2X55 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.