Y. pestis Plasminogen Activator Pla in Complex with Human Plasminogen Activation Loop Peptide ALP11. Determined by X-ray diffraction at 2.03 Å resolution. Released 6 Jun 2012.
Explore 4DCB in 3D Show helices and sheets RCSB PDB PDBe
4DCB contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| α-helix | 11-13 | 3 | |
| β-strand | 14-32 | 19 | 1 |
| β-strand | 39-62 | 24 | 1 |
| β-strand | 65-74 | 10 | 1 |
| β-strand | 78-86 | 9 | 1 |
| β-strand | 97-122 | 26 | 1 |
| β-strand | 126-144 | 19 | 1 |
| β-strand | 147-150 | 4 | 1 |
| β-strand | 155-158 | 4 | 1 |
| α-helix | 159-160 | 2 | |
| β-strand | 164-185 | 22 | 1 |
| β-strand | 188-208 | 21 | 1 |
| β-strand | 213-234 | 22 | 1 |
| β-strand | 239-250 | 12 | 1 |
| β-strand | 255-259 | 5 | 1 |
| β-strand | 275-291 | 17 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulase/fibrinolysin | A | protein | 297 | Yersinia pestis | P17811 (AlphaFold model) |
| Plasminogen | F | protein | 11 | Homo sapiens | P00747 (AlphaFold model) |
>4DCB_1 Coagulase/fibrinolysin (chains A) LIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKISQLDWKIKNVAILKGDISWDPYSF LTLNARGWTSLASGSGNMDNYDWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWLLQDE NYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLAGQYR INDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAKVFAE FTYSKYDEGKGGTQTIDKNSGDSVSIGGDAAGISNKNYTVTAGLQYRFGGGHHHHHH
>4DCB_2 Plasminogen (chains F) KCPGRVVGGCK
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
| C8E | (hydroxyethyloxy)tri(ethyloxy)octane | C16 H34 O5 | 1 |
| MRD | (4R)-2-methylpentane-2,4-diol | C6 H14 O2 | 4 |
Water and common crystallization additives (MPD) are not listed.
Structural basis for activation of an integral membrane protease by lipopolysaccharide. Eren, E., van den Berg, B. J Biol Chem (2012) 287:23971-23976. DOI 10.1074/jbc.M112.376418 · PubMed
Other PDB entries of the same protein (UniProt P17811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DCB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.