Yersinia Pestis Plasminogen Activator Pla (Native). Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Jul 2010.
Explore 2X56 in 3D Show helices and sheets RCSB PDB PDBe
2X56 contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-32 | 19 | 1 |
| β-strand | 39-62 | 24 | 1 |
| β-strand | 65-74 | 10 | 1 |
| β-strand | 78-86 | 9 | 1 |
| β-strand | 97-122 | 26 | 1 |
| β-strand | 126-144 | 19 | 1 |
| β-strand | 147-150 | 4 | 1 |
| α-helix | 151-153 | 3 | |
| β-strand | 155-158 | 4 | 1 |
| α-helix | 159-160 | 2 | |
| β-strand | 164-185 | 22 | 1 |
| β-strand | 188-208 | 21 | 1 |
| β-strand | 213-236 | 24 | 1 |
| β-strand | 239-250 | 12 | 1 |
| β-strand | 270 | 1 | 1 |
| α-helix | 272-274 | 3 | |
| β-strand | 275-291 | 17 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulase/fibrinolysin | A | protein | 292 | YERSINIA PESTIS | P17811 (AlphaFold model) |
>2X56_1 COAGULASE/FIBRINOLYSIN (chains A) ASSQLIPNISPDSFTVAASTGMLSGKSHEMLYDAETGRKISQLDWKIKNVAILKGDISWD PYSFLTLNARGWTSLASGSGNMDDYDWMNENQSEWTDHSSHPATNVNHANEYDLNVKGWL LQDENYKAGITAGYQETRFSWTATGGSYSYNNGAYTGNFPKGVRVIGYNQRFSMPYIGLA GQYRINDFELNALFKFSDWVRAHDNDEHYMRDLTFREKTSGSRYYGTVINAGYYVTPNAK VFAEFTYSKYDEGKGGTQTIDKNSGDSVSIGGDAAGISNKNYTVTAGLQYRF
| ID | Name | Formula | Copies |
|---|---|---|---|
| C8E | (hydroxyethyloxy)tri(ethyloxy)octane | C16 H34 O5 | 18 |
An Active Site Water Network in the Plasminogen Activator Pla from Yersinia Pestis. Eren, E., Murphy, M., Goguen, J. et al. Structure (2010) 18:809. DOI 10.1016/J.STR.2010.03.013 · PubMed
Other PDB entries of the same protein (UniProt P17811 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2X56 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.