2XIK: Human YSK1

Structure of Human YSK1 (Yeast Sps1-Ste20-related Kinase 1). Determined by X-ray diffraction at 1.97 Å resolution. Released 14 Jul 2010.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,474
Mol. weight: 34.19 kDa
Ligands: J60
Released: 14 Jul 2010

Explore 2XIK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XIK contains 19 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
β-strand	12	1	1
α-helix	16-19	4
β-strand	20-28	9	1
β-strand	32-39	8	1
β-strand	45-52	8	1
α-helix	60-72	13
β-strand	78	1	2
β-strand	81-87	7	1
β-strand	90-96	7	1
β-strand	101-102	2	2
α-helix	103-107	5
α-helix	111-113	3
α-helix	114-133	20
β-strand	136-137	2	3
α-helix	143-145	3
β-strand	146-148	3	2
β-strand	154-156	3	2
β-strand	163-164	2	3
β-strand	172	1	4
α-helix	179-181	3
α-helix	184-187	4
β-strand	192	1	4
α-helix	195-210	16
α-helix	220-226	7
α-helix	231-233	3
α-helix	241-250	10
α-helix	255-257	3
α-helix	259-260	2
α-helix	261-264	4
α-helix	268-272	5
α-helix	277-280	4
α-helix	281-291	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine protein kinase 25	A	protein	294	HOMO SAPIENS	O00506 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XIK_1 SERINE/THREONINE PROTEIN KINASE 25 (chains A)
SMAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDE
IEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIAT
ILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTP
FWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQH
SKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSE

Ligands and cofactors

ID	Name	Formula	Copies
J60	5-[(E)-(5-chloro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-N-[2-(diethylamin…	C22 H27 Cl N4 O2	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Structure of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1). Muniz, J.R.C., Rellos, P., Vollmar, M. et al. To be published.

Other PDB entries of the same protein (UniProt O00506 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z4V 1.64 Å, Structure of Serine-Threonine kinase STK25 in complex with compound
3W8H 2.43 Å, Crystal structure of CCM3 in complex with the C-terminal regulatory domain of STK25
4NZW 3.58 Å, Crystal Structure of STK25-MO25 Complex

Browse structure collections

About this viewer

MolViewer shows 2XIK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.