7Z4V: Serine-Threonine kinase STK25

Structure of Serine-Threonine kinase STK25 in complex with compound. Determined by X-ray diffraction at 1.64 Å resolution. Released 6 Apr 2022.

Method: X-ray diffraction
Resolution: 1.64 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,549
Mol. weight: 34.36 kDa
Ligands: IB5
Released: 6 Apr 2022

Explore 7Z4V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z4V contains 20 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
β-strand	12	1	1
α-helix	16-18	3
β-strand	20-25	6	1
β-strand	32-39	8	1
β-strand	45-52	8	1
α-helix	57-59	3
α-helix	60-71	12
β-strand	78	1	2
β-strand	81-87	7	1
β-strand	90-96	7	1
β-strand	101-102	2	2
α-helix	103-106	4
α-helix	111-113	3
α-helix	114-133	20
β-strand	136-137	2	3
α-helix	143-145	3
β-strand	146-148	3	2
β-strand	154-156	3	2
β-strand	163-164	2	3
β-strand	172	1	4
α-helix	179-181	3
α-helix	184-187	4
β-strand	192	1	4
α-helix	195-210	16
α-helix	220-226	7
α-helix	231-233	3
α-helix	241-250	10
α-helix	255-257	3
α-helix	259-260	2
α-helix	261-264	4
α-helix	268-273	6
α-helix	277-280	4
α-helix	281-292	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 25	A	protein	297	Homo sapiens	O00506 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7Z4V_1 Serine/threonine-protein kinase 25 (chains A)
GSMAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAED
EIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIA
TILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGT
PFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQ
HSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEGS

Ligands and cofactors

ID	Name	Formula	Copies
IB5	~{N}-(5-~{tert}-butyl-1~{H}-pyrazol-3-yl)-4-pyrrolidin-1-ylsulfonyl-benzamide	C18 H24 N4 O3 S	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Targeting non-alcoholic fatty liver disease: Design, X-ray co-crystal structure and synthesis of 'first-in-kind' inhibitors of serine/threonine kinase25. Kiyeleko, S., Hocine, S., Mautino, G. et al. Bioorg Med Chem Lett (2022) 75:128950-128950. DOI 10.1016/j.bmcl.2022.128950 · PubMed

Other PDB entries of the same protein (UniProt O00506 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XIK 1.97 Å, Structure of Human YSK1 (Yeast Sps1-Ste20-related Kinase 1)
3W8H 2.43 Å, Crystal structure of CCM3 in complex with the C-terminal regulatory domain of STK25
4NZW 3.58 Å, Crystal Structure of STK25-MO25 Complex

Browse structure collections

About this viewer

MolViewer shows 7Z4V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.