2XZG: Clathrin Terminal Domain

Clathrin Terminal Domain Complexed with Pitstop 1. Determined by X-ray diffraction at 1.7 Å resolution. Released 17 Aug 2011.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,341
Mol. weight: 41.44 kDa
Ligands: VH1
Released: 17 Aug 2011

Explore 2XZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XZG contains 10 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	15-18	4
α-helix	22-24	3
β-strand	30-34	5	2
β-strand	37-44	8	2
β-strand	47-54	8	2
β-strand	62-65	4	2
β-strand	70-73	4	3
β-strand	79-84	6	3
β-strand	87-92	6	3
β-strand	97-103	7	3
β-strand	108-113	6	4
β-strand	118-123	6	4
β-strand	126-131	6	4
α-helix	136-138	3
β-strand	139-143	5	4
α-helix	144-145	2
α-helix	146-148	3
α-helix	151	1
β-strand	152-158	7	5
β-strand	164-173	10	5
β-strand	176-185	10	5
β-strand	190-194	5	5
β-strand	198-204	7	6
β-strand	213-222	10	6
β-strand	225-232	8	6
α-helix	235-237	3
α-helix	240-245	6
β-strand	246-250	5	6
β-strand	261-267	7	7
β-strand	272-277	6	7
β-strand	281-286	6	7
β-strand	292-297	6	7
β-strand	303-309	7	1
β-strand	314-319	6	1
β-strand	323-329	7	1
α-helix	334-340	7
α-helix	345-356	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Clathrin heavy chain 1	A	protein	365	HOMO SAPIENS	Q00610 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XZG_1 CLATHRIN HEAVY CHAIN 1 (chains A)
FMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPS
NPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTV
ALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVG
AMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTG
NQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRIS
GETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAG
AEELF

Ligands and cofactors

ID	Name	Formula	Copies
VH1	2-(4-aminobenzyl)-1,3-dioxo-2,3-dihydro-1H-benzo[de]isoquinoline-5-sulfonate	C19 H13 N2 O5 S	1

Water and common crystallization additives (ACT, GOL, PEG) are not listed.

Primary citation

Role of the Clathrin Terminal Domain in Regulating Coated Pit Dynamics Revealed by Small Molecule Inhibition. Von Kleist, L., Stahlschmidt, W., Bulut, H. et al. Cell (2011) 146:471. DOI 10.1016/J.CELL.2011.06.025 · PubMed

Other PDB entries of the same protein (UniProt Q00610 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9C0Y 1.4 Å, Clathrin terminal domain complexed with Pitstop 2c
9C0Z 1.51 Å, Clathrin terminal domain complexed with pitstop 2d
6E4L 1.6 Å, The structure of the N-terminal domain of human clathrin heavy chain 1 (nTD) in complex…
4G55 1.69 Å, Clathrin terminal domain complexed with pitstop 2
7BN2 1.97 Å, Clathrin heavy chain N-terminal domain bound to Non structured protein 3 from Eastern…
7BN1 1.97 Å, Clathrin heavy chain N-terminal domain complexed with peptide from Protein mu-NS of…
6QNN 2.03 Å, Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif
7ZX4 2.08 Å, Clathrin N-terminal domain in complex with a HURP phospho-peptide
6QNP 2.7 Å, Clathrin heavy chain N-terminal domain bound to GTSE1 lidl motif

Browse structure collections

About this viewer

MolViewer shows 2XZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.