Crystal structure of BPSS1823, a Mip-like chaperone from Burkholderia pseudomallei. Determined by X-ray diffraction at 0.91 Å resolution. Released 25 May 2011.
Explore 2Y78 in 3D Show helices and sheets RCSB PDB PDBe
2Y78 contains 5 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -5--3 | 3 | |
| β-strand | 4-5 | 2 | 1 |
| β-strand | 11-16 | 6 | 1 |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 2 |
| α-helix | 23 | 1 | |
| β-strand | 28-37 | 10 | 1 |
| β-strand | 42-45 | 4 | 1 |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 64-69 | 6 | |
| β-strand | 74 | 1 | 2 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 85-87 | 3 | |
| β-strand | 94 | 1 | 3 |
| β-strand | 98 | 1 | 3 |
| β-strand | 104-112 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase | A | protein | 133 | BURKHOLDERIA PSEUDOMALLEI | Q63J95 (AlphaFold model) |
>2Y78_1 PEPTIDYL-PROLYL CIS-TRANS ISOMERASE (chains A) MGSSHHHHHHSSGLVPRGSHMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDG QKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPP NATLVFEVELLDV
The Structure of a Burkholderia Pseudomallei Immunophilin-Inhibitor Complex Reveals New Approaches to Antimicrobial Development. Norville, I.H., O'Shea, K., Sarkar-Tyson, M. et al. Biochem J (2011) 437:413. DOI 10.1042/BJ20110345 · PubMed
Other PDB entries of the same protein (UniProt Q63J95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Y78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.