2Y7S: Factor H binding protein

Structure of a designed meningococcal antigen (factor H binding protein, mutant G1) inducing broad protective immunity. Determined by X-ray diffraction at 1.9 Å resolution. Released 27 Jul 2011.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: NEISSERIA MENINGITIDIS SEROGROUP B
Chains: 2
Atoms: 4,228
Mol. weight: 55.44 kDa
Released: 27 Jul 2011

Explore 2Y7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y7S contains 18 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	16-21	6
α-helix	23-24	2
α-helix	29	1
α-helix	31	1
β-strand	34-35	2	1
β-strand	45-50	6	2
β-strand	53-57	5	2
α-helix	61	1
β-strand	62-63	2	1
α-helix	65-67	3
α-helix	69	1
β-strand	73-84	12	2
β-strand	87-100	14	2
β-strand	104-115	12	2
β-strand	123-136	14	2
β-strand	138	1	3
α-helix	139	1
β-strand	140	1	4
α-helix	141-143	3
β-strand	148-157	10	3
β-strand	160-170	11	3
β-strand	175-181	7	3
α-helix	186-188	3
β-strand	191-199	9	3
β-strand	204	1	4
β-strand	205-213	9	3
β-strand	216-226	11	3
β-strand	232-239	8	3
β-strand	242	1	5
β-strand	244	1	5
β-strand	246-253	8	3

Chain B: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	16-21	6
α-helix	23-24	2
α-helix	29	1
β-strand	34-35	2	6
β-strand	45-50	6	7
β-strand	53-57	5	7
β-strand	62-63	2	6
α-helix	65-67	3
α-helix	69	1
β-strand	73-84	12	7
β-strand	87-100	14	7
β-strand	104-116	13	7
β-strand	122-136	15	7
β-strand	138	1	8
α-helix	139	1
β-strand	140	1	9
α-helix	141-143	3
β-strand	148-157	10	8
β-strand	160-170	11	8
β-strand	175-181	7	8
α-helix	186-188	3
β-strand	191-199	9	8
β-strand	204	1	9
β-strand	205-213	9	8
β-strand	216-226	11	8
β-strand	232-241	10	8
β-strand	244-253	10	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Factor H binding protein	A, B	protein	256	NEISSERIA MENINGITIDIS SEROGROUP B	Q9JXV4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Y7S_1 FACTOR H BINDING PROTEIN (chains A, B)
MVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTG
KLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAK
RQFRIGDLGGEHTAFNQLPDGKAEYRGTAFGSDDAGGKLTYTIDFTKKQGNGKIEHLKSP
ELNVELASAEIKADGKSHAVILGDVRYGSEEKGSYSLGIFGGRAQEVAGSAEVKTVNGIR
HIGLAAKQLEHHHHHH

Primary citation

Rational Design of a Meningococcal Antigen Inducing Broad Protective Immunity. Scarselli, M., Arico, B., Brunelli, B. et al. Sci Transl Med (2011) 3:91RA6. DOI 10.1126/SCITRANSLMED.3002234 · PubMed

Other PDB entries of the same protein (UniProt Q9JXV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UP2 1.6 Å, Murine Fab JAR 4 bound to meningococcal Factor H binding protein
5NQZ 1.63 Å, Structure of a fHbp(V1.1):PorA(P1.16) chimera. Fusion at fHbp position 309.
7LCV 1.7 Å, Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein
2YPV 1.8 Å, Crystal structure of the Meningococcal vaccine antigen factor H binding protein in…
7KET 2.0 Å, Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein
5O14 2.19 Å, Co-crystal structure of a cross-reactive bactericidal human antibody targeting…
2W80 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
2W81 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
4AYD 2.4 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…
6XZW 2.4 Å, Crystal structure of the meningococcal vaccine antigen fHbp in complex with a…
4AYE 2.8 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…
7SBZ 2.9 Å, JAR5 Fab bound to fHbp v1.1 crystallized in space group I422

Browse structure collections

About this viewer

MolViewer shows 2Y7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.