7KET: Immunoglobulin gamma, kappa light chain

Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Jun 2021.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Neisseria meningitidis
Chains: 3
Atoms: 5,249
Mol. weight: 76.83 kDa
Released: 9 Jun 2021

Explore 7KET in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KET contains 22 α-helices and 65 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-51	7	8
β-strand	57	1	9
β-strand	58-60	3	8
β-strand	65	1	6
β-strand	68-73	6	6
α-helix	74-76	3
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-99	8	8
β-strand	109-112	4	8
β-strand	116-118	3	8
β-strand	119-120	2	7
β-strand	126	1	10
α-helix	127-128	2
β-strand	129-133	5	11
α-helix	134-136	3
β-strand	144-154	11	11
β-strand	155	1	10
β-strand	160-163	4	12
β-strand	172-174	3	11
α-helix	175-177	3
β-strand	178-179	2	11
β-strand	185-194	10	11
α-helix	195-197	3
β-strand	204-209	6	12
β-strand	214-219	6	12

Chain B: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	1
β-strand	11-14	4	2
β-strand	20-25	6	1
β-strand	35-40	6	2
β-strand	46-51	6	2
β-strand	55-56	2	2
β-strand	64-67	4	1
β-strand	73-77	5	1
α-helix	82-84	3
β-strand	87-92	6	2
α-helix	98	1
β-strand	99-100	2	2
β-strand	105-108	4	2
β-strand	113	1	3
β-strand	116-120	5	4
α-helix	121-123	3
α-helix	124-129	6
β-strand	131-141	11	4
β-strand	142	1	3
β-strand	147-152	6	5
β-strand	161-165	5	4
α-helix	167-169	3
β-strand	175-184	10	4
α-helix	185-188	4
β-strand	193-199	7	5
β-strand	208-212	5	5

Chain C: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	16-21	6
α-helix	29	1
α-helix	31	1
β-strand	34-35	2	13
β-strand	45-50	6	14
β-strand	51	1	9
β-strand	53-57	5	14
α-helix	61	1
β-strand	62-63	2	13
α-helix	65-67	3
α-helix	69	1
β-strand	73-84	12	14
β-strand	87-100	14	14
β-strand	104-115	12	14
β-strand	123-125	3	14
β-strand	129-136	8	14
β-strand	138	1	15
α-helix	139	1
β-strand	140	1	16
α-helix	141-143	3
β-strand	149-158	10	15
β-strand	161-171	11	15
β-strand	176-182	7	15
α-helix	187-189	3
β-strand	192-200	9	15
β-strand	205	1	16
β-strand	206-213	8	15
β-strand	218-227	10	15
β-strand	233-242	10	15
β-strand	245-254	10	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin gamma, kappa light chain	B	protein	217	Homo sapiens
Immunoglobulin gamma, heavy chain Fd fragment	A	protein	235	Homo sapiens
Factor H binding protein	C	protein	263	Neisseria meningitidis	Q9JXV4 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7KET_1 Immunoglobulin gamma, kappa light chain (chains B)
AEIVLTQSPGTLSLSPGERATLSCRASQSFSSFSLAWYQQKPGQAPRLLIYAPSNRATGI
ADRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPITFGQGTRLEIKRTVAAPSVFIF
PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKLYACEVTHQGLSSPVTKSFNRGECS

Sequence of entity 2 (A), FASTA

>7KET_2 Immunoglobulin gamma, heavy chain Fd fragment (chains A)
QVQLVESGGGLVQPGGSLRLSCVTSGFTFRSYAMTWVRQAPGKGLEWVSSISHSGGSTKY
ADSVKGRLTISRDDSMDTLYLQMNSLRAEDTAIYYCAKDQISYPAASPLDYWGRGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKLEHHHHHH

Sequence of entity 3 (C), FASTA

>7KET_3 Factor H binding protein (chains C)
CSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNG
DSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHS
GKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGK
IEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEV
KTVNGIRHIGLAAKQLEHHHHHH

Primary citation

Two human antibodies to a meningococcal serogroup B vaccine antigen enhance binding of complement Factor H by stabilizing the Factor H binding site. Sands, N.A., Beernink, P.T. PLoS Pathog (2021) 17:e1009655-e1009655. DOI 10.1371/journal.ppat.1009655 · PubMed

Other PDB entries of the same protein (UniProt Q9JXV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UP2 1.6 Å, Murine Fab JAR 4 bound to meningococcal Factor H binding protein
5NQZ 1.63 Å, Structure of a fHbp(V1.1):PorA(P1.16) chimera. Fusion at fHbp position 309.
7LCV 1.7 Å, Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein
2YPV 1.8 Å, Crystal structure of the Meningococcal vaccine antigen factor H binding protein in…
2Y7S 1.9 Å, Structure of a designed meningococcal antigen (factor H binding protein, mutant G1)…
5O14 2.19 Å, Co-crystal structure of a cross-reactive bactericidal human antibody targeting…
2W80 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
2W81 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
4AYD 2.4 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…
6XZW 2.4 Å, Crystal structure of the meningococcal vaccine antigen fHbp in complex with a…
4AYE 2.8 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…
7SBZ 2.9 Å, JAR5 Fab bound to fHbp v1.1 crystallized in space group I422

Browse structure collections

About this viewer

MolViewer shows 7KET directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.